Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NE21
Symbols FAM90A18

Gene

 Compartment GO Term (1)

AA Sequence

MMARRDPKSWAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCGAFGHTARSTRCPMKCWKAALVP      1 - 70
ATLGKKEGKENLKPWKPRVEANPGPLNKDKGEKEERPRQQDPQRKALLHMFSGKPPEKPLPNGKGSTESS     71 - 140
DHLRVASGPMPVHTTSKRPRVDPVLADRSAAEMSGRGSVLASLSPLRKASLSSSSSLGPKERQTGAAADM    141 - 210
PQPAVRHQGREPLLVVKPTHSSPEGGCREVPQAASKTHGLLQAARPQAQDKRPAVTSQPCPPAATHSLGL    211 - 280
GSNLSFGPGAKRPAQAPIQACLKFPKKPRLGPFQIPESAIQGGELGAPGNLQPPPAATELGPSTSPQMGR    281 - 350
RTPAQVPSVDWQPPHSTPCLPTAQACTMSHHSAASHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP    351 - 420
GAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE                              421 - 464
//

Publication (3)

PMID Year Title
18622769 2008 PEG-grafted chitosan nanoparticles as an injectable carrier for sustained protein release.
17684299 2007 Characterization and evolution of the novel gene family FAM90A in primates originated by multiple duplication and rearrangement events.
16421571 2006 DNA sequence and analysis of human chromosome 8.