Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -1.500 4.2e-02
hepatocellular carcinoma 1.100 4.5e-05
ovarian cancer 1.100 2.5e-02
pancreatic cancer 1.100 1.8e-03
pancreatic carcinoma 1.100 1.8e-03

Synonym

Accession A6NDU8 A2RRM9
Symbols

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

AA Sequence

MAAAVSSVVRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQA      1 - 70
ILDMTYFEENKLVDEDFPEDSSSQKVKELISFLSEPEILVKENNMHPKHCNLLGDELLECLSWRRGALLY     71 - 140
MYCHSLTKRREWLLRKSSLLKKYLLDGISYLLQMLNYRCPIQLNEGVSFQDLDTAKLLSAGIFSDIHLLA    141 - 210
MMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTT    211 - 280
NAKQILNFFHHRCN                                                            281 - 294
//

Text Mined References (6)

PMID Year Title