Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
hepatocellular carcinoma 550 4.53143454035712E-5
pancreatic cancer 2300 0.00180685394426438
pancreatic carcinoma 567 0.00180685394426439
ovarian cancer 8492 0.0250546316903201
acute myeloid leukemia 785 0.0418072189994003

Expression

  Differential Expression (5)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
pancreatic cancer 1.100 0.002
pancreatic carcinoma 1.100 0.002
acute myeloid leukemia -1.500 0.042
ovarian cancer 1.100 0.025

Synonym

Accession A6NDU8 A2RRM9
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG

 Compartment GO Term (2)

AA Sequence

MAAAVSSVVRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQA      1 - 70
ILDMTYFEENKLVDEDFPEDSSSQKVKELISFLSEPEILVKENNMHPKHCNLLGDELLECLSWRRGALLY     71 - 140
MYCHSLTKRREWLLRKSSLLKKYLLDGISYLLQMLNYRCPIQLNEGVSFQDLDTAKLLSAGIFSDIHLLA    141 - 210
MMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTT    211 - 280
NAKQILNFFHHRCN                                                            281 - 294
//

Text Mined References (6)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.