Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent (20)

AA Sequence

MRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIALTMLDPHLKTPMYFFLQNLSFLEIS      1 - 70
FTATCVPRFLYSISTGNKIITYNACVIQLFFADLFGVTEFFLLATMSYDRYVAICKPLHYMAIMSNKVCK     71 - 140
TMVICCWMAALMIILPPLSLGFHLEFCDSNVINHFGCDALPILKIPCSDTSLIEQMVVASAVLTFIITLV    141 - 210
CVVLSYTYIIRTILKFPSVQQKKKAFSTCSSHITVVSITYGSCIFIYIKPSAKEEVNINKGVSVLISSIS    211 - 280
PMLNSFIYTLRNEQVKQAFHDSLKKIAFRLKK                                          281 - 312
//

Text Mined References (2)

PMID Year Title
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
16541075 2006 The finished DNA sequence of human chromosome 12.