Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NDE8 GAGE-12H
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQKGEDEGASAGQGP      1 - 70
KPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC                            71 - 117
//

Text Mined References (2)

PMID Year Title
18179644 2008 An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.
15772651 2005 The DNA sequence of the human X chromosome.