Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.83
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.300 0.000
glioblastoma -1.200 0.000
adult high grade glioma -1.100 0.020
atypical teratoid/rhabdoid tumor -1.300 0.000
pilocytic astrocytoma -1.300 0.000

Gene RIF (1)

PMID Text
16359841 Cloning and characterization of the TMEM90A (capucin) ortholog in mouse.

AA Sequence

MESLSELQNPLLPRSPAHLHGPYPYPETPPSWSCQEKLYSYLLGGAGPAGAHQLLDPGSLQLAVEAWYRP      1 - 70
SCLLGRDKVKEPRAGSCETSFTEDREPQEGPPEQPTGPGQAAENVTIQTVSYGVQEELRDQEDDQEEEES     71 - 140
DATSTESESEDNFLTLPPRDHLGLTLFSMLCCFWPLGIAAFYFSQGTSKAISKGDFRLASTTSRRALFLA    141 - 210
TLAIAVGAGLYVAVVVALAAYMSQNGHG                                              211 - 238
//

Text Mined References (6)

PMID Year Title
22363774 2012 The dispanins: a novel gene family of ancient origin that contains 14 human members.
16359841 2006 Capucin: a novel striatal marker down-regulated in rodent models of Huntington disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.