Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.83
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 4.16539930618142E-10
atypical teratoid/rhabdoid tumor 1095 4.23044415131476E-5
glioblastoma 5572 9.17608914123227E-5
pilocytic astrocytoma 3086 1.48504224599195E-4
adult high grade glioma 2148 0.0200939533945509
Disease Target Count Z-score Confidence
Huntington's disease 72 3.033 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.300 0.000
glioblastoma -1.200 0.000
adult high grade glioma -1.100 0.020
atypical teratoid/rhabdoid tumor -1.300 0.000
pilocytic astrocytoma -1.300 0.000

Synonym

Accession A6NDD5
Symbols DSPC1
CAPUCIN
IFITMD4
TMEM90A

Gene

  Ortholog (10)

Gene RIF (1)

PMID Text
16359841 Cloning and characterization of the TMEM90A (capucin) ortholog in mouse.

AA Sequence

MESLSELQNPLLPRSPAHLHGPYPYPETPPSWSCQEKLYSYLLGGAGPAGAHQLLDPGSLQLAVEAWYRP      1 - 70
SCLLGRDKVKEPRAGSCETSFTEDREPQEGPPEQPTGPGQAAENVTIQTVSYGVQEELRDQEDDQEEEES     71 - 140
DATSTESESEDNFLTLPPRDHLGLTLFSMLCCFWPLGIAAFYFSQGTSKAISKGDFRLASTTSRRALFLA    141 - 210
TLAIAVGAGLYVAVVVALAAYMSQNGHG                                              211 - 238
//

Text Mined References (6)

PMID Year Title
22363774 2012 The dispanins: a novel gene family of ancient origin that contains 14 human members.
16359841 2006 Capucin: a novel striatal marker down-regulated in rodent models of Huntington disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.