Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent (20)


  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

AA Sequence

PFLNPIIYSLRNKEIKTAMWRLFVKIYFLQK                                           281 - 311

Publication (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.