Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent (20)


  Disease Sources (1)

Disease Target Count P-value
diabetes mellitus 1663 0.00119395946551149

AA Sequence

PFLNPIIYSLRNKEIKTAMWRLFVKIYFLQK                                           281 - 311

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.