Property Summary

NCBI Gene PubMed Count 4
PubMed Score 46.09
PubTator Score 10.95

Knowledge Summary

Patent

No data available

Synonym

Accession A6ND01
Symbols JUNO
FOLR4
Folbp3

Gene

PDB

5F4E   5F4Q   5JKA   5JKB   5JKC   5JKD   5JKE  

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG

Gene RIF (2)

PMID Text
27309818 crystal structures of human IZUMO1 and JUNO in unbound and bound conformations
27309808 crystal structures of human IZUMO1, JUNO and the IZUMO1-JUNO complex, establishing the structural basis for the IZUMO1-JUNO-mediated sperm-oocyte interaction

AA Sequence

MACWWPLLLELWTVMPTWAGDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSP      1 - 70
LYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWW     71 - 140
EDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKW    141 - 210
FEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS                                  211 - 250
//

Text Mined References (5)

PMID Year Title
27309818 2016 Molecular architecture of the human sperm IZUMO1 and egg JUNO fertilization complex.
27309808 2016 Structure of IZUMO1-JUNO reveals sperm-oocyte recognition during mammalian fertilization.
24739963 2014 Juno is the egg Izumo receptor and is essential for mammalian fertilization.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
11111049 2000 Identification of two putative novel folate receptor genes in humans and mouse.