Property Summary

NCBI Gene PubMed Count 4
Grant Count 8
Funding $626,445.87
PubMed Score 46.09
PubTator Score 10.95

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
27309818 crystal structures of human IZUMO1 and JUNO in unbound and bound conformations
27309808 crystal structures of human IZUMO1, JUNO and the IZUMO1-JUNO complex, establishing the structural basis for the IZUMO1-JUNO-mediated sperm-oocyte interaction

AA Sequence

MACWWPLLLELWTVMPTWAGDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSP      1 - 70
LYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWW     71 - 140
EDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKW    141 - 210
FEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS                                  211 - 250
//

Text Mined References (5)

PMID Year Title
27309818 2016 Molecular architecture of the human sperm IZUMO1 and egg JUNO fertilization complex.
27309808 2016 Structure of IZUMO1-JUNO reveals sperm-oocyte recognition during mammalian fertilization.
24739963 2014 Juno is the egg Izumo receptor and is essential for mammalian fertilization.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
11111049 2000 Identification of two putative novel folate receptor genes in humans and mouse.