Property Summary

NCBI Gene PubMed Count 4
PubMed Score 57.01
PubTator Score 10.95

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MACWWPLLLELWTVMPTWAGDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSP      1 - 70
LYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWW     71 - 140
EDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKW    141 - 210
FEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS                                  211 - 250
//

Text Mined References (5)

PMID Year Title