Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.08
PubTator Score 0.08

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NCF5
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

AA Sequence

MLLSGMRESQGTEVSLRTISTQDLRLLVSFAYSGVVRARWPGLLRAAQAALQYQSSSCLDLCQKGLARGL      1 - 70
SPARCLALFPMAEAPGLERLWSKARHYLLTHLPAVALCPAFPSLPAACLAELLDSDELHVQEEFEAFVAA     71 - 140
RCWLAANPETQESEAKALLRCVRFGRMSTRELRRVRAAGLLPPLTPDLLHQLMVEADVPGQERRREPDRA    141 - 210
LVVIGGDGLRPDMALRQPSRAVWWARAFRCGVGLVRTVEWGQLPALPAPGRFRHGAASLAGSELYVCGGQ    211 - 280
DFYSHSNTLASTLRWEPSQEDWEEMAPLSQARSLFSLVALDGKLYALGGRHNDVALDSVETYNPELNVWR    281 - 350
PAPALPAPCFAHAAAILEGQLYVSGGCGGTGQYLASLMHYDPKLEKPGTFLSPMGVPRAGHVMAALGGRL    351 - 420
YVAGGLGETEDLLSFEAYELRTDSWTHLAPLPSPHVGAASAVLQGELLVLGGYSHRTYALSHLIHAYCPG    421 - 490
LGRWLCLGTLPRPRAEMPACILTLPAVQHIALVPTPHQTKPAG                               491 - 533
//

Text Mined References (4)

PMID Year Title
23676014 2013 Update on the Kelch-like (KLHL) gene family.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.