Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.07
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.500 2.6e-07
ependymoma 1.600 4.1e-12
glioblastoma 1.100 1.1e-05
inflammatory breast cancer -1.300 3.4e-06
intraductal papillary-mucinous adenoma (... -1.100 6.9e-04
osteosarcoma -1.450 2.0e-04
subependymal giant cell astrocytoma 1.105 4.6e-03

AA Sequence

MRLSRRPETFLLAFVLLCTLLGLGCPLHCEICTAAGSRCHGQMKTCSSDKDTCVLLVGKATSKGKELVHT      1 - 70
YKGCIRSQDCYSGVISTTMGPKDHMVTSSFCCQSDGCNSAFLSVPLTNLTENGLMCPACTASFRDKCMGP     71 - 140
MTHCTGKENHCVSLSGHVQAGIFKPRFAMRGCATESMCFTKPGAEVPTGTNVLFLHHIECTHSP          141 - 204
//

Text Mined References (5)

PMID Year Title