Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Pick disease 1894 2.6e-03
group 4 medulloblastoma 1855 2.7e-02

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma 1.100 2.7e-02
Pick disease -1.100 2.6e-03

AA Sequence

MEVNPPKQEHLLALKVMRLTKPTLFTNIPVTCEEKDLPGDLFNQLMRDDPSTVNGAEVLMLGEMLTLPQN      1 - 70
FGNIFLGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIG     71 - 140
THILVCAVSYTTQAGEKMYFRKFFKFQVLKPLDVKTKFYNAESDLSSVTDEVFLEAQIQNMTTSPMFMEK    141 - 210
VSLEPSIMYNVTELNSVSQAGECVSTFGSRAYLQPMDTRQYLYCLKPKNEFAEKAGIIKGVTVIGKLDIV    211 - 280
WKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCKITNCSERTMDLVLEMCNTNSIH    281 - 350
WCGISGRQLGKLHPSSSLCLALTLLSSVQGLQSISGLRLTDTFLKRTYEYDDIAQVCVVSSAIKVES       351 - 417
//

Text Mined References (9)

PMID Year Title