Property Summary

NCBI Gene PubMed Count 13
PubMed Score 178.85
PubTator Score 0.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma -1.400 3.2e-04
intraductal papillary-mucinous neoplasm ... 1.700 9.0e-04

Gene RIF (1)

AA Sequence

MAGAENWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARW      1 - 70
EDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNC     71 - 140
LVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILP    141 - 210
RKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK              211 - 270
//

Text Mined References (17)

PMID Year Title