Property Summary

NCBI Gene PubMed Count 9
Grant Count 7
R01 Count 5
Funding $481,659.58
PubMed Score 22.94
PubTator Score 2.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Gene RIF (6)

PMID Text
25556590 We analysed thymic tissues from patients with trisomy 13 (n = 4), trisomy 18 (n = 14) and trisomy 21 (n = 13) for histological alterations, and for the expression of functionally important molecules such as beta5t, a thymoproteasome subunit, and cathepsins.
24293611 Histological diversity of type AB thymoma correlates with expression of a functional marker beta5t and abundance of TdT-positive lymphocytes.
21941364 provide the first evidence that the mechanism underlying BTZ resistance in these tumor cells is impaired binding of BTZ to the mutant beta5 subunit of the proteasome
21836487 Proteasome beta5t is expressed in most type B and in some type AB thymomas and is a marker useful in differentiating type B3 thymomas from thymic carcinomas when used in combination with other diagnostic markers.
19289856 Human beta5t was expressed in approximately 80% of cortical thymic epithelial cells and some cortical dendritic cells
17540904 results suggest a key role for beta5t in generating the MHC class I-restricted CD8(+) T cell repertoire during thymic selection

AA Sequence

MALQDVCKWQSPDTQGPSPHLPRAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSS      1 - 70
CGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREGQLPSVASAAKLLSAMMSQYR     71 - 140
GLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALARCAVA    141 - 210
HATHRDAYSGGSVDLFHVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAEDRELS    211 - 280
VGPGEVTPGDSRMPAGTETV                                                      281 - 300
//

Text Mined References (10)

PMID Year Title
25556590 2015 Decreased expression of thymus-specific proteasome subunit ?5t in Down syndrome patients.
24293611 2014 Expression of thymoproteasome subunit ?5t in type AB thymoma.
21941364 2012 Impaired bortezomib binding to mutant ?5 subunit of the proteasome is the underlying basis for bortezomib resistance in leukemia cells.
21836487 2011 Expression of proteasome subunit ?5t in thymic epithelial tumors.
19289856 2009 Exclusive expression of proteasome subunit {beta}5t in the human thymic cortex.
17540904 2007 Regulation of CD8+ T cell development by thymus-specific proteasomes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.