Property Summary

NCBI Gene PubMed Count 9
PubMed Score 27.90

Knowledge Summary

Patent

No data available

AA Sequence

MTVEQKFGLFSAEIKEADPLAASEASQPKPCPPEVTPHYIWIDFLVQRFEIAKYCSSDQVEIFSSLLQRS      1 - 70
MSLNIGRAKGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQGE     71 - 140
KRLREDISIMIKFWTAMFSDKKYLTASQLVPPADIGDLLEQLVEENTGSLSGPAKDFYQRGFDFFNKITN    141 - 210
VSAVIKPYPKGDERKKACLSALSEVTVQPGCSLPSNPEAIVLDVDYKSGTPMQSAAKAPYLAKFKVKRCG    211 - 280
VSELEKEGLRCRSDSEDECSTQEADGQKISWQAAIFKLGDDCRQKSYWGARMPTDRILRLPASQDMLALQ    281 - 350
IIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQ    351 - 420
QARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMI    421 - 490
MGGKMEATPFKWFMEMCVQATWLCGEPGPYMDVVVSLVTIMLDTGLPCFRGQTIKLLKHRFSPNMTEREA    491 - 560
ANFIMKVIQSCFLSNRSRTYNMIQYYQNDIPY                                          561 - 592
//

Text Mined References (10)

PMID Year Title