Property Summary

NCBI Gene PubMed Count 9
PubMed Score 27.25

Knowledge Summary

Patent

No data available

Synonym

Accession A4QPH2 Q6ICJ0 Q6ZT68 Q8WUK7
Symbols

Gene

PANTHER Protein Class (2)

AA Sequence

MTVEQKFGLFSAEIKEADPLAASEASQPKPCPPEVTPHYIWIDFLVQRFEIAKYCSSDQVEIFSSLLQRS      1 - 70
MSLNIGRAKGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQGE     71 - 140
KRLREDISIMIKFWTAMFSDKKYLTASQLVPPADIGDLLEQLVEENTGSLSGPAKDFYQRGFDFFNKITN    141 - 210
VSAVIKPYPKGDERKKACLSALSEVTVQPGCSLPSNPEAIVLDVDYKSGTPMQSAAKAPYLAKFKVKRCG    211 - 280
VSELEKEGLRCRSDSEDECSTQEADGQKISWQAAIFKLGDDCRQKSYWGARMPTDRILRLPASQDMLALQ    281 - 350
IIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQ    351 - 420
QARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMI    421 - 490
MGGKMEATPFKWFMEMCVQATWLCGEPGPYMDVVVSLVTIMLDTGLPCFRGQTIKLLKHRFSPNMTEREA    491 - 560
ANFIMKVIQSCFLSNRSRTYNMIQYYQNDIPY                                          561 - 592
//

Text Mined References (10)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
10591208 1999 The DNA sequence of human chromosome 22.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.