Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.03
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 2.03555410407449E-17
osteosarcoma 7933 1.71441559538174E-7
Pick disease 1893 2.91345889940383E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 3.49839275042567E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00197374753685775
Disease Target Count Z-score Confidence
Transient cerebral ischemia 14 3.072 1.5

Expression

  Differential Expression (5)

Synonym

Accession A4D1U4 Q9ULS3
Symbols LCHN
PRO2561

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

AA Sequence

MVEQGDAAPLLRWAEGPAVSLPQAPQPQAGGWGRGGGGGARPAAEPPRRREPEEPAAPEVLLQPGRLELG      1 - 70
DVEEDQVVAVFVVTFDPRSGNMVEWCLPQDIDLEGVEFKSMASGSHKIQSDFIYFRKGPFFGLACFANMP     71 - 140
VESELERGARMKSVGILSPSYTLLYRYMHFLENQVRHQLEMPGHYSHLAAFYEDKKGVLHAGPGRGSSLP    141 - 210
PVYWLPSIHRYMYPEMKITHPAGCMSQFIKFFGEQILILWKFALLRKRILIFSPPPVGVVCYRVYCCCCL    211 - 280
ANVSLPGIGGTIPESKPFFYVNVADIESLEVEVSYVACTTEKIFEEKRELYDVYVDNQNVKTHHDHLQPL    281 - 350
LKINSADREKYRRLNEQRQMLLYSQEVEEDYNPCEEDLFVLFFLEQNNRIFQTLLEVSASQDKTLTAEHA    351 - 420
RGMGLDPQGDRSFLLDLLEAYGIDVMLVIDNPCCP                                       421 - 455
//

Text Mined References (5)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.