Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.10
PubTator Score 1.50

Knowledge Summary


No data available



  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.800 3.5e-05
intraductal papillary-mucinous carcinoma... 1.400 2.0e-03
lung carcinoma 1.200 2.0e-17
osteosarcoma 2.619 1.7e-07
Pick disease 1.500 2.9e-05

AA Sequence

RGMGLDPQGDRSFLLDLLEAYGIDVMLVIDNPCCP                                       421 - 455

Text Mined References (6)

PMID Year Title