Property Summary

NCBI Gene PubMed Count 20
PubMed Score 145.87
PubTator Score 60.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

AA Sequence

MEAGPPGSARPAEPGPCLSGQRGADHTASASLQSVAGTEPGRHPQAVAAVLPAGGCGERMGVPTPKQFCP      1 - 70
ILERPLISYTLQALERVCWIKDIVVAVTGENMEVMKSIIQKYQHKRISLVEAGVTRHRSIFNGLKALAED     71 - 140
QINSKLSKPEVVIIHDAVRPFVEEGVLLKVVTAAKEHGAAGAIRPLVSTVVSPSADGCLDYSLERARHRA    141 - 210
SEMPQAFLFDVIYEAYQQCSDYDLEFGTECLQLALKYCCTKAKLVEGSPDLWKVTYKRDLYAAESIIKER    211 - 280
ISQEICVVMDTEEDNKHVGHLLEEVLKSELNHVKVTSEALGHAGRHLQQIILDQCYNFVCVNVTTSDFQE    281 - 350
TQKLLSMLEESSLCILYPVVVVSVHFLDFKLVPPSQKMENLMQIREFAKEVKERNILLYGLLISYPQDDQ    351 - 420
KLQESLRQGAIIIASLIKERNSGLIGQLLIA                                           421 - 451
//

Text Mined References (24)

PMID Year Title