Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A2VCL2 A1A4V1 A4QMU0 Q5JSU0 Q5JSU7
Symbols CCDC162
C6orf184
C6orf185
bA425D10.3
bA425D10.7

Gene

 Compartment GO Term (0)

AA Sequence

MFKTLPEKAAFKALKRTLQLIAPLHDIVAYLVSFAKLGNCPACFEFPRSPNPLRGDWGGTEGIGSELQEL      1 - 70
QNMIDSLQSPQDPIRVAQALLLRREVIFLQFDAAVRHLIRRTFLAAGNVPAYQSVTDGMCHGLPALSNSL     71 - 140
RKSIFASQLSLPQPLDPRSLQAFELFPWRAFLEDGGPFPVMSNSPDTLEYNMQLCLCGLSDRDRKVAHGE    141 - 210
LVGVQLLLEDVLSSYHVTMEAPQRQQATLGKNTQPDWSKVPGFRSQFRSSPKTSELLEGLCDAVMSFALL    211 - 280
RSFLILWKQLEVLKEHWGRLKLQGQDINSVSLHKRFSELYETDVLYPSMKAIARQMGKEDEFEGFIVNNQ    281 - 350
SVLPPSGASEVEIKTHQLQKLLENCEIQMIQEVLRKVNREMTLVLSEKCKEECSLPTDLWKHQVMKENFS    351 - 420
VSRPQIVEKFIQRLMNYQDDGVEITFRKDHLEACLLSLGCDVMARECSNFETYSMCYEHVLHHARQRLSQ    421 - 490
KEQELDATQRGQGPPEDSAGQIAELSHDMIMEITTLRAQLTDLEEVNLNLKKQIRKEVQEEYEALVRALF    491 - 560
ETCLHIKEKLDDNQLNLIQKVCELIGEVRTEGIDNMKDLKKKWCSASPDEGMKENPAKEQLWALEQDNCS    561 - 630
LANLVCKVRSLGRWRLAVQQACFQAQLSRTEKESIQSKKEYLRIKLMAEREVGLFRQQVLALRQALARAQ    631 - 700
ADSARMWKQQDSQAQLLKELEHRVTQEALTQQQLHFMKTSRMEKLLEDVGQKEQQLQLLSKEAERASKLG    701 - 770
QLQQKKMKRDLHQMRSRLAQERSVKLDALQRAEELQGQLHDAQRSAVPMGSSGDLISQAQYSPTSASTSS    771 - 840
RYSQQRFLKTNLKGSKITRWIQRPQTVPIKHKKRTDDVFLPNMAENVQLTAFQVQTAPSRFPFRADW       841 - 907
//

Text Mined References (7)

PMID Year Title
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.