Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A2VCK2 B7ZBC6
Symbols

Gene

 GO Component (1)

 Compartment GO Term (2)

AA Sequence

MAGGSPAAKRVVVYRNGDPFFPGSQLVVTQRRFPTMEAFLCEVTSAVQAPLAVRALYTPCHGHPVTNLAD      1 - 70
LKNRGQYVAAGFERFHKLHYLPHRGKDPGGKSCRLQGPPVTRHLCDGAIGRQLPAGAPSYIHVFRNGDLV     71 - 140
SPPFSLKLSQAASQDWETVLKLLTEKVKLQSGAVCKLCTLEGLPLSAGKELVTGHYYVAVGEDEFKDLPY    141 - 210
LELLVPSPSLPRGCWQPPGSKSRPHRQGAQGHRAQVTQPSPKEPDRIKPSAFYARPQQTIQPRSKLPTLS    211 - 280
FPSGVIGVYGAPHRRKETAGALEVADDEDTQTEEPLDQRAAQIVEEALSLENQPGAGAAISASAPALPS     281 - 349
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20236041 2010 The doublecortin gene family and disorders of neuronal structure.
16869982 2006 The evolving doublecortin (DCX) superfamily.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.