Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.73
PubTator Score 0.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 1.7e-10

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.100 1.7e-10

Protein-protein Interaction (2)

Gene RIF (1)

AA Sequence

MEAATAPEVAAGSKLKVKEASPADAEPPQASPGQGAGSPTPQLLPPIEEHPKIWLPRALRQTYIRKVGDT      1 - 70
VNLLIPFQGKPKPQAIWTHDGCALDTRRVSVRNGEQDSILFIREAQRADSGRYQLRVQLGGLEATATIDI     71 - 140
LVIERPGPPQSIKLVDVWGFSATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTVLEHYHRTSCIVSDLI    141 - 210
IGNSYAFRVFAENQCGLSETAPITTDLAHIQKAATVYKTKGFAQRDFSEAPKFTQPLADCTTVTGYNTQL    211 - 280
FCCVRASPRPKIIWLKNKMDIQGNPKYRALTHLGICSLEIRKPGPFDGGIYTCKAVNPLGEASVDCRVDV    281 - 350
KVPN                                                                      351 - 354
//

Text Mined References (5)

PMID Year Title