Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 1.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Spermatogenic Failure, Nonobstructive, Y-Linked 15 0.0 0.0
Disease Target Count
Azoospermia 110

 Compartment GO Term (0)

AA Sequence

MFIFNSIADDIFPLISCVGAIHCNILAIRTGNDFAAIKLQVIKLIYLMIWHSLVIISPVVTLAFFPASLK      1 - 70
QGSLHFLLIIYFVLLLTPWLEFSKSGTHLPSNTKNNSSMVGKYGCLS                            71 - 117
//

Text Mined References (4)

PMID Year Title