Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 1.66

Knowledge Summary

Patent

No data available

Synonym

Accession A2RUG3
Symbols XKRY1

Gene

 Compartment GO Term (0)

AA Sequence

MFIFNSIADDIFPLISCVGAIHCNILAIRTGNDFAAIKLQVIKLIYLMIWHSLVIISPVVTLAFFPASLK      1 - 70
QGSLHFLLIIYFVLLLTPWLEFSKSGTHLPSNTKNNSSMVGKYGCLS                            71 - 117
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9381176 1997 Functional coherence of the human Y chromosome.