Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.57
PubTator Score 3.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6241 4.5e-05

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell -1.300 4.5e-05

AA Sequence

MAGQHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVAAVAQMDF      1 - 70
ISKNFVYRTLPFDQLVQRAAEEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKE     71 - 140
EQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPL    141 - 210
FSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILD    211 - 280
RALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE                                       281 - 315
//

Text Mined References (10)

PMID Year Title