Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.57
PubTator Score 3.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
medulloblastoma, large-cell 6,234

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell -1.300 0.000

AA Sequence

MAGQHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVAAVAQMDF      1 - 70
ISKNFVYRTLPFDQLVQRAAEEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKE     71 - 140
EQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPL    141 - 210
FSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILD    211 - 280
RALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE                                       281 - 315
//

Text Mined References (10)

PMID Year Title
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
20972222 2011 Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
20739293 2010 Expanding role of the jumonji C domain as an RNA hydroxylase.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.