Property Summary

NCBI Gene PubMed Count 6
PubMed Score 35.73
PubTator Score 14.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (1)

AA Sequence

MGSKEDAGKGCPAAGGVSSFTIQSILGGGPSEAPREPVGWPARKRSLSVSSEEEEPDDGWKAPACFCPDQ      1 - 70
HGPKEQGPKHHPPIPFPCLGTPKGSGGSGPGGLERTPFLSPSHSDFKEEKERLLPAGSPSPGSERPRDGG     71 - 140
AERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSA    141 - 210
ELEAANMAHASAQTLVSMPLVFRDSSLLRVPVPRSLAFPAPLYYPGSNLSALPLYNLYNKLDY           211 - 273
//

Text Mined References (7)

PMID Year Title