Property Summary

NCBI Gene PubMed Count 6
Grant Count 2
R01 Count 2
Funding $323,750
PubMed Score 35.11
PubTator Score 14.32

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
19253379 propose that hemizygous deletions of HMX2 and HMX3 are responsible for inner ear malformations, vestibular dysfunction, and congenital sensorineural hearing loss

AA Sequence

MGSKEDAGKGCPAAGGVSSFTIQSILGGGPSEAPREPVGWPARKRSLSVSSEEEEPDDGWKAPACFCPDQ      1 - 70
HGPKEQGPKHHPPIPFPCLGTPKGSGGSGPGGLERTPFLSPSHSDFKEEKERLLPAGSPSPGSERPRDGG     71 - 140
AERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSA    141 - 210
ELEAANMAHASAQTLVSMPLVFRDSSLLRVPVPRSLAFPAPLYYPGSNLSALPLYNLYNKLDY           211 - 273
//

Text Mined References (7)

PMID Year Title
19253379 2009 Molecular (SNP) analyses of overlapping hemizygous deletions of 10q25.3 to 10qter in four patients: evidence for HMX2 and HMX3 as candidate genes in hearing and vestibular function.
15558495 2005 A whole-genome scan for 24-hour respiration rate: a major locus at 10q26 influences respiration during sleep.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9004130 1996 Refined mapping of a gene for split hand-split foot malformation (SHFM3) on chromosome 10q25.
7647458 1995 Phylogenetic conservation and physical mapping of members of the H6 homeobox gene family.
7510254 1994 A novel NK-related mouse homeobox gene: expression in central and peripheral nervous structures during embryonic development.