Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.18
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.600 0.000
non-inflammatory breast cancer -2.400 0.000
ovarian cancer -1.500 0.000
chronic rhinosinusitis -1.606 0.041

AA Sequence

MQRLPAATRATLILSLAFASLHSACSAEASSSNSSSLTAHHPDPGTLEQCLNVDFCPQAARCCRTGVDEY      1 - 70
GWIAAAVGWSLWFLTLILLCVDKLMKLTPDEPKDLQA                                      71 - 107
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.