Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.18
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.4e-06
Breast cancer 3578 8.6e-05
psoriasis 6694 1.0e-02
chronic rhinosinusitis 512 4.1e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -1.100 8.6e-05
chronic rhinosinusitis -1.606 4.1e-02
ovarian cancer -1.500 1.4e-06
psoriasis -1.100 1.0e-02

AA Sequence

MQRLPAATRATLILSLAFASLHSACSAEASSSNSSSLTAHHPDPGTLEQCLNVDFCPQAARCCRTGVDEY      1 - 70
GWIAAAVGWSLWFLTLILLCVDKLMKLTPDEPKDLQA                                      71 - 107
//

Text Mined References (6)

PMID Year Title