Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.400 6.1e-03
astrocytic glioma 1.600 1.1e-02
Astrocytoma, Pilocytic 1.900 8.6e-07
Breast cancer -1.500 3.8e-06
ependymoma 3.300 5.3e-03
glioblastoma 1.600 2.9e-05
group 3 medulloblastoma 1.800 1.3e-02
intraductal papillary-mucinous neoplasm ... 1.400 2.4e-03
oligodendroglioma 1.400 2.8e-02
osteosarcoma -1.448 1.6e-03
pancreatic ductal adenocarcinoma liver m... -1.428 1.7e-03
pituitary cancer 1.400 2.2e-02

AA Sequence

MFENLNTALTPKLQASRSFPHLSKPVAPGSAPLGSGEPGGPGLWVGSSQHLKNLGKAMGAKVNDFLRRKE      1 - 70
PSSLGSVGVTEINKTAGAQLASGTDAAPEAWLEDERSVLQETFPRLDPPPPITRKRTPRALKTTQDMLIS     71 - 140
SQPVLSSLEYGTEPSPGQAQDSAPTAQPDVPADASQPEATMEREERGKVLPNGEVSLSVPDLIHKDSQDE    141 - 210
SKLKMTECRRASSPSLIERNGFKLSLSPISLAESWEDGSPPPQARTSSLDNEGPHPDLLSFE            211 - 272
//

Text Mined References (12)

PMID Year Title