Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.11
PubTator Score 76.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.464 0.000
invasive ductal carcinoma -1.100 0.001

Synonym

Accession A1KXE4 Q2TAZ6 Q6NZ40 Mani
Symbols MANI

Gene

Gene RIF (1)

PMID Text
20716133 novel protein MANI (myelin-associated neurite-outgrowth inhibitor)localizes to neural membranes; findings describe the novel MANI-Cdc27-APC pathway as an important cascade that prevents neurons from extending axons

AA Sequence

MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAV      1 - 70
PPYSSSPNPYQTAVYPVRSAYPQQSPYAQQGTYYTQPLYAAPPHVIHHTTVVQPNGMPATVYPAPIPPPR     71 - 140
GNGVTMGMVAGTTMAMSAGTLLTAHSPTPVAPHPVTVPTYRAPGTPTYSYVPPQW                   141 - 195
//

Text Mined References (10)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22771904 2012 Characterizing the neurite outgrowth inhibitory effect of Mani.
20716133 2011 The novel protein MANI modulates neurogenesis and neurite-cone growth.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.