Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.11
PubTator Score 76.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Multiple myeloma 1328 2.34690640158992E-4
invasive ductal carcinoma 2950 7.79810424472881E-4

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.464 0.000
invasive ductal carcinoma -1.100 0.001

Synonym

Accession A1KXE4 Q2TAZ6 Q6NZ40 Mani
Symbols MANI

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
20716133 novel protein MANI (myelin-associated neurite-outgrowth inhibitor)localizes to neural membranes; findings describe the novel MANI-Cdc27-APC pathway as an important cascade that prevents neurons from extending axons

AA Sequence

MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAV      1 - 70
PPYSSSPNPYQTAVYPVRSAYPQQSPYAQQGTYYTQPLYAAPPHVIHHTTVVQPNGMPATVYPAPIPPPR     71 - 140
GNGVTMGMVAGTTMAMSAGTLLTAHSPTPVAPHPVTVPTYRAPGTPTYSYVPPQW                   141 - 195
//

Text Mined References (10)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22771904 2012 Characterizing the neurite outgrowth inhibitory effect of Mani.
20716133 2011 The novel protein MANI modulates neurogenesis and neurite-cone growth.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.