Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.88
PubTator Score 76.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Multiple myeloma 1332 2.3e-04
invasive ductal carcinoma 2951 7.8e-04

Expression

  Differential Expression (2)

Disease log2 FC p
invasive ductal carcinoma -1.100 7.8e-04
Multiple myeloma 1.464 2.3e-04

Gene RIF (1)

AA Sequence

MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAV      1 - 70
PPYSSSPNPYQTAVYPVRSAYPQQSPYAQQGTYYTQPLYAAPPHVIHHTTVVQPNGMPATVYPAPIPPPR     71 - 140
GNGVTMGMVAGTTMAMSAGTLLTAHSPTPVAPHPVTVPTYRAPGTPTYSYVPPQW                   141 - 195
//

Text Mined References (11)

PMID Year Title