Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 1.780 1.4e-02
active ulcerative colitis 1.343 2.6e-02
ductal carcinoma in situ -1.200 9.2e-04
invasive ductal carcinoma -1.300 7.0e-03
ovarian cancer 1.600 2.4e-04

AA Sequence

MKVVGNYRVNTANSSTDTSGEHLTCLRSQLFVAYRNGRVDEAVSLGFLDCWIGGDLTNFKGCYLTNQLPI      1 - 70
QIFTAIFDMNTDVIILSQFMYYRLKNQKKKMIFQPQLFKDSITREKVRLSLWGVLCPVYIPYSFR          71 - 135
//

Text Mined References (6)

PMID Year Title