Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.10
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0
Disease Target Count Z-score Confidence
Alcohol abuse 5 3.346 1.7

Synonym

Accession A0PG75 B2RXK5
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG

AA Sequence

MASKDAQNQRRGLPGFLPGAPDPDQSLPASSNPGNQAWQLSLPLPSSFLPTVSLPPGLEYLSQLDLIIIH      1 - 70
QQVELLGMILGTETSNKYEIKNSLGQRIYFAVEESICFNRTFCSTLRSCTLRITDNSGREVITVNRPLRC     71 - 140
NSCWCPCYLQELEIQAPPGTIVGYVTQKWDPFLPKFTIQNANKEDILKIVGPCVTCGCFGDVDFEVKTIN    141 - 210
EKLTIGKISKYWSGFVNDVFTNADNFGIHVPADLDVTVKAAMIGACFLFDFMFFEHSLAGL             211 - 271
//

Text Mined References (4)

PMID Year Title
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.