Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.10
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.2
Disease Target Count Z-score Confidence
Alcohol abuse 50 3.36 1.7

AA Sequence

MASKDAQNQRRGLPGFLPGAPDPDQSLPASSNPGNQAWQLSLPLPSSFLPTVSLPPGLEYLSQLDLIIIH      1 - 70
QQVELLGMILGTETSNKYEIKNSLGQRIYFAVEESICFNRTFCSTLRSCTLRITDNSGREVITVNRPLRC     71 - 140
NSCWCPCYLQELEIQAPPGTIVGYVTQKWDPFLPKFTIQNANKEDILKIVGPCVTCGCFGDVDFEVKTIN    141 - 210
EKLTIGKISKYWSGFVNDVFTNADNFGIHVPADLDVTVKAAMIGACFLFDFMFFEHSLAGL             211 - 271
//

Text Mined References (4)

PMID Year Title