Property Summary

NCBI Gene PubMed Count 4
PubMed Score 228.68

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count Z-score Confidence
Lymphoma 57 4.251 2.1
Amebiasis 22 3.54 1.8
Leukemia 88 3.281 1.6


Accession A0M8Q6
Symbols C7


AA Sequence

YLSLTPEQWKSHRSYSCRVTHEGSTVEKTVAPAECS                                       71 - 106

Text Mined References (4)

PMID Year Title
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
2115572 1990 Structure and expression of the human immunoglobulin lambda genes.
814163 1976 Physicochemical and functional characterization of the C1r subunit of the first complement component.