Property Summary

NCBI Gene PubMed Count 4
PubMed Score 230.69

Knowledge Summary

Patent

No data available

TINX Plot

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLVSDFNPGAVTVAWKADGSPVKVGVETTKPSKQSNNKYAASS      1 - 70
YLSLTPEQWKSHRSYSCRVTHEGSTVEKTVAPAECS                                       71 - 106
//

Text Mined References (9)

PMID Year Title