Property Summary

NCBI Gene PubMed Count 4
PubMed Score 228.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession A0M8Q6
Symbols C7

Gene

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLVSDFYPGAVTVAWKADGSPVKVGVETTKPSKQSNNKYAASS      1 - 70
YLSLTPEQWKSHRSYSCRVTHEGSTVEKTVAPAECS                                       71 - 106
//

Text Mined References (4)

PMID Year Title
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
2115572 1990 Structure and expression of the human immunoglobulin lambda genes.
814163 1976 Physicochemical and functional characterization of the C1r subunit of the first complement component.