Property Summary

NCBI Gene PubMed Count 16
Grant Count 10
R01 Count 9
Funding $970,864.16
PubMed Score 18.97
PubTator Score 11.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
26089541 E2F8 is overexpressed in Lung Cancer and is required for the growth of LC cells. E2F8 knockdown reduced the expression of UHRF1. These findings implicate E2F8 as a novel therapeutic target for LC treatment.
25892397 transcription factor E2F8 is involved in the polyploidization during mouse and human decidualization
23064264 The results identify E2F8 as a repressor and E2F1 as an activator of a transcriptional network controlling polyploidization in mammalian cells.
20068156 Analyses indicated that E2F8 could bind to regulatory elements of cyclin D1, regulating its transcription and promoting accumulation of S-phase cells. Findings suggest that E2F8 contributes to the oncogenic potential of HCC
18202719 E2F7 and E2F8 act upstream of E2F1, and influence the ability of cells to undergo a DNA-damage response.
16179649 E2F8 may have an important role in repressing the expression of E2F-target genes in the S-phase of the cell cycle.
15897886 The similarities between E2F-7 and E2F-8 define a new subgroup of the E2F family, and further imply that E2F-7 and E2F-8 may act through overlapping mechanisms in mediating cell cycle control.

AA Sequence

MENEKENLFCEPHKRGLMKTPLKESTTANIVLAEIQPDFGPLTTPTKPKEGSQGEPWTPTANLKMLISAV      1 - 70
SPEIRNRDQKRGLFDNRSGLPEAKDCIHEHLSGDEFEKSQPSRKEKSLGLLCHKFLARYPNYPNPAVNND     71 - 140
ICLDEVAEELNVERRRIYDIVNVLESLHMVSRLAKNRYTWHGRHNLNKTLGTLKSIGEENKYAEQIMMIK    141 - 210
KKEYEQEFDFIKSYSIEDHIIKSNTGPNGHPDMCFVELPGVEFRAASVNSRKDKSLRVMSQKFVMLFLVS    211 - 280
TPQIVSLEVAAKILIGEDHVEDLDKSKFKTKIRRLYDIANVLSSLDLIKKVHVTEERGRKPAFKWTGPEI    281 - 350
SPNTSGSSPVIHFTPSDLEVRRSSKENCAKNLFSTRGKPNFTRHPSLIKLVKSIESDRRKINSAPSSPIK    351 - 420
TNKAESSQNSAPFPSKMAQLAAICKMQLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELTAPSL    421 - 490
IQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSVTPPQGLSPTVCTTHSSKATGSKDSTD    491 - 560
ATTEKAANDTSKASASTRPGSLLPAPERQGAKSRTREPAGERGSKRASMLEDSGSKKKFKEDLKGLENVS    561 - 630
ATLFPSGYLIPLTQCSSLGAESILSGKENSSALSPNHRIYSSPIAGVIPVTSSELTAVNFPSFHVTPLKL    631 - 700
MVSPTSVAAVPVGNSPALASSHPVPIQNPSSAIVNFTLQHLGLISPNVQLSASPGSGIVPVSPRIESVNV    701 - 770
APENAGTQQGRATNYDSPVPGQSQPNGQSVAVTGAQQPVPVTPKGSQLVAESFFRTPGGPTKPTSSSCMD    771 - 840
FEGANKTSLGTLFVPQRKLEVSTEDVH                                               841 - 867
//

Text Mined References (21)

PMID Year Title
26089541 2015 E2F8 as a Novel Therapeutic Target for Lung Cancer.
25892397 2015 Involvement of atypical transcription factor E2F8 in the polyploidization during mouse and human decidualization.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23064264 2012 E2F8 is essential for polyploidization in mammalian cells.
22903062 2012 E2F7 and E2F8 promote angiogenesis through transcriptional activation of VEGFA in cooperation with HIF1.
22802528 2012 E2F7, a novel target, is up-regulated by p53 and mediates DNA damage-dependent transcriptional repression.
20068156 2010 E2F8 contributes to human hepatocellular carcinoma via regulating cell proliferation.
19201609 2009 Atypical E2Fs: new players in the E2F transcription factor family.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
More...