Property Summary

NCBI Gene PubMed Count 19
PubMed Score 22.75
PubTator Score 11.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma 1.100 5.6e-03
Atopic dermatitis 1.400 7.3e-04
atypical teratoid / rhabdoid tumor 2.300 1.3e-05
Breast cancer 2.900 4.2e-13
cystic fibrosis -1.639 1.2e-05
ductal carcinoma in situ 1.500 2.6e-02
Endometriosis 1.322 4.7e-02
ependymoma 1.300 5.6e-05
glioblastoma 1.700 3.4e-06
group 3 medulloblastoma 2.300 1.5e-04
interstitial cystitis -1.600 4.3e-03
intraductal papillary-mucinous carcinoma... 2.900 1.6e-04
intraductal papillary-mucinous neoplasm ... 3.900 3.7e-04
invasive ductal carcinoma 2.000 1.8e-04
juvenile dermatomyositis 1.215 1.1e-05
lung adenocarcinoma 1.007 1.6e-02
lung cancer 3.500 5.1e-06
malignant mesothelioma 2.800 1.0e-07
medulloblastoma, large-cell 2.200 1.6e-05
non-small cell lung cancer 2.089 1.2e-22
osteosarcoma -2.259 3.2e-03
ovarian cancer 1.800 4.4e-04
pancreatic cancer 1.600 5.2e-06
primitive neuroectodermal tumor 2.500 9.2e-06
psoriasis 1.900 2.7e-04

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MENEKENLFCEPHKRGLMKTPLKESTTANIVLAEIQPDFGPLTTPTKPKEGSQGEPWTPTANLKMLISAV      1 - 70
SPEIRNRDQKRGLFDNRSGLPEAKDCIHEHLSGDEFEKSQPSRKEKSLGLLCHKFLARYPNYPNPAVNND     71 - 140
ICLDEVAEELNVERRRIYDIVNVLESLHMVSRLAKNRYTWHGRHNLNKTLGTLKSIGEENKYAEQIMMIK    141 - 210
KKEYEQEFDFIKSYSIEDHIIKSNTGPNGHPDMCFVELPGVEFRAASVNSRKDKSLRVMSQKFVMLFLVS    211 - 280
TPQIVSLEVAAKILIGEDHVEDLDKSKFKTKIRRLYDIANVLSSLDLIKKVHVTEERGRKPAFKWTGPEI    281 - 350
SPNTSGSSPVIHFTPSDLEVRRSSKENCAKNLFSTRGKPNFTRHPSLIKLVKSIESDRRKINSAPSSPIK    351 - 420
TNKAESSQNSAPFPSKMAQLAAICKMQLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELTAPSL    421 - 490
IQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSVTPPQGLSPTVCTTHSSKATGSKDSTD    491 - 560
ATTEKAANDTSKASASTRPGSLLPAPERQGAKSRTREPAGERGSKRASMLEDSGSKKKFKEDLKGLENVS    561 - 630
ATLFPSGYLIPLTQCSSLGAESILSGKENSSALSPNHRIYSSPIAGVIPVTSSELTAVNFPSFHVTPLKL    631 - 700
MVSPTSVAAVPVGNSPALASSHPVPIQNPSSAIVNFTLQHLGLISPNVQLSASPGSGIVPVSPRIESVNV    701 - 770
APENAGTQQGRATNYDSPVPGQSQPNGQSVAVTGAQQPVPVTPKGSQLVAESFFRTPGGPTKPTSSSCMD    771 - 840
FEGANKTSLGTLFVPQRKLEVSTEDVH                                               841 - 867
//

Text Mined References (24)

PMID Year Title