Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.86
PubTator Score 2.65

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.386 0.000
medulloblastoma, large-cell -1.200 0.003
breast carcinoma 1.100 0.034
ovarian cancer 1.800 0.000

Synonym

Accession A0AVI4 A6NH49 A6NI98 D3DVP8
Symbols D4S2561E

Gene

Gene RIF (4)

PMID Text
26210183 TRC8 and TMEM129 are endoplasmic reticulum-associated degradation ubiquitin E3 ligases for viral and cellular targeting of MHC class I. (Review)
25030448 TMEM129 contains an unusual cysteine-only RING with intrinsic E3 ligase activity and is recruited to US11 via Derlin-1.
24807418 TMEM129 is an integral part of the Endoplasmic Reticulum-resident dislocation complex mediating US11-induced HLA class I degradation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDSPEVTFTLAYLVFAVCFVFTPNEFHAAGLTVQNLLSGWLGSEDAAFVPFHLRRTAATLLCHSLLPLGY      1 - 70
YVGMCLAASEKRLHALSQAPEAWRLFLLLAVTLPSIACILIYYWSRDRWACHPLARTLALYALPQSGWQA     71 - 140
VASSVNTEFRRIDKFATGAPGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHELSPDSNLPVQLL    141 - 210
TIRVASTNPAVQAFDIWLNSTEYGELCEKLRAPIRRAAHVVIHQSLGDLFLETFASLVEVNPAYSVPSSQ    211 - 280
ELEACIGCMQTRASVKLVKTCQEAATGECQQCYCRPMWCLTCMGKWFASRQDPLRPDTWLASRVPCPTCR    281 - 350
ARFCILDVCTVR                                                              351 - 362
//

Text Mined References (10)

PMID Year Title
26210183 2015 Identifying the ERAD ubiquitin E3 ligases for viral and cellular targeting of MHC class I.
25030448 2014 TMEM129 is a Derlin-1 associated ERAD E3 ligase essential for virus-induced degradation of MHC-I.
24807418 2014 A high-coverage shRNA screen identifies TMEM129 as an E3 ligase involved in ER-associated protein degradation.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
20972438 2010 A multi-stage genome-wide association study of bladder cancer identifies multiple susceptibility loci.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20348956 2010 A sequence variant at 4p16.3 confers susceptibility to urinary bladder cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.