Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.86
PubTator Score 2.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.6e-06
ovarian cancer 8520 3.2e-06
medulloblastoma, large-cell 6241 3.0e-03
breast carcinoma 1638 3.4e-02

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.100 3.4e-02
medulloblastoma, large-cell -1.200 3.0e-03
osteosarcoma -2.386 2.6e-06
ovarian cancer 1.800 3.2e-06

Gene RIF (5)

AA Sequence

MDSPEVTFTLAYLVFAVCFVFTPNEFHAAGLTVQNLLSGWLGSEDAAFVPFHLRRTAATLLCHSLLPLGY      1 - 70
YVGMCLAASEKRLHALSQAPEAWRLFLLLAVTLPSIACILIYYWSRDRWACHPLARTLALYALPQSGWQA     71 - 140
VASSVNTEFRRIDKFATGAPGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHELSPDSNLPVQLL    141 - 210
TIRVASTNPAVQAFDIWLNSTEYGELCEKLRAPIRRAAHVVIHQSLGDLFLETFASLVEVNPAYSVPSSQ    211 - 280
ELEACIGCMQTRASVKLVKTCQEAATGECQQCYCRPMWCLTCMGKWFASRQDPLRPDTWLASRVPCPTCR    281 - 350
ARFCILDVCTVR                                                              351 - 362
//

Text Mined References (11)

PMID Year Title