Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.92
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.100 3.4e-04
atypical teratoid / rhabdoid tumor 1.700 6.3e-08
chronic rhinosinusitis -1.868 2.7e-02
ependymoma 2.000 3.6e-02
glioblastoma 1.100 3.4e-07
group 3 medulloblastoma 1.100 1.8e-03
lung cancer 1.800 3.2e-03
medulloblastoma, large-cell 1.300 3.8e-05
osteosarcoma 1.885 1.3e-03
primitive neuroectodermal tumor 1.500 2.7e-03

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MMLSRAKPAVGRGVQHTDKRKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDTNLWIGYCAFHL      1 - 70
GDYKRALEEYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKASKSRLQNRLLFHLAHKFNDEKKL     71 - 140
MSFHQNLQDVTEDQLSLASIHYMRSHYQEAIDIYKRILLDNREYLALNVYVALCYYKLDYYDVSQEVLAV    141 - 210
YLQQIPDSTIALNLKACNHFRLYNGRAAEAELKSLMDNASSSFEFAKELIRHNLVVFRGGEGALQVLPPL    211 - 280
VDVIPEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVG    281 - 350
GSASECDTIPGRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEAFLLIQ    351 - 420
SEKMKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYSAKAFDVLERL    421 - 490
DPNPEYWEGKRGACVGIFQMIIAGREPKETLREVLHLLRSTGNTQVEYMIRIMKKWAKENRVSI          491 - 554
//

Text Mined References (12)

PMID Year Title