Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.11
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.43402997327529E-15
atypical teratoid / rhabdoid tumor 4369 6.30746349889251E-8
pediatric high grade glioma 2712 1.29547335905613E-5
glioblastoma 5572 2.34984354849284E-5
medulloblastoma, large-cell 6234 4.69914231193798E-5
group 3 medulloblastoma 2254 1.66065464730705E-4
osteosarcoma 7933 0.0012966376978971
primitive neuroectodermal tumor 3031 0.00270542647377112
lung cancer 4473 0.00319952544950099
chronic rhinosinusitis 512 0.0273321125000962
Disease Target Count Z-score Confidence
Joubert syndrome 62 3.977 2.0
Polydactyly 93 3.407 1.7
Hydrocephalus 60 3.042 1.5

Expression

  Differential Expression (10)

Synonym

Accession A0AVF1 A4D1S3 B7Z5M0 C9J2N7 F8W724 Q9H9S8 Q9NTC0
Symbols DYF13
IFT56
dyf-13

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (3)

PMID Text
24596149 TTC26 is an intraflagellar transport protein required for transport of motility-related proteins into flagella.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MMLSRAKPAVGRGVQHTDKRKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDTNLWIGYCAFHL      1 - 70
GDYKRALEEYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKASKSRLQNRLLFHLAHKFNDEKKL     71 - 140
MSFHQNLQDVTEDQLSLASIHYMRSHYQEAIDIYKRILLDNREYLALNVYVALCYYKLDYYDVSQEVLAV    141 - 210
YLQQIPDSTIALNLKACNHFRLYNGRAAEAELKSLMDNASSSFEFAKELIRHNLVVFRGGEGALQVLPPL    211 - 280
VDVIPEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVG    281 - 350
GSASECDTIPGRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEAFLLIQ    351 - 420
SEKMKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYSAKAFDVLERL    421 - 490
DPNPEYWEGKRGACVGIFQMIIAGREPKETLREVLHLLRSTGNTQVEYMIRIMKKWAKENRVSI          491 - 554
//

Text Mined References (11)

PMID Year Title
24596149 2014 TTC26/DYF13 is an intraflagellar transport protein required for transport of motility-related proteins into flagella.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...