Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.93
PubTator Score 3.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Juvenile arthritis 124
Disease Target Count P-value
malignant mesothelioma 3163 7.3098827313658E-10
pilocytic astrocytoma 3086 7.33432575337274E-8
lung cancer 4473 5.25403964261399E-7
posterior fossa group A ependymoma 1511 1.46361600690464E-6
osteosarcoma 7933 2.80142217989553E-6
pediatric high grade glioma 2712 1.22406585024251E-5
glioblastoma 5572 6.59151411424054E-5
lung adenocarcinoma 2714 2.18524002566019E-4
interstitial cystitis 2299 3.41910429619834E-4
ulcerative colitis 2087 3.50449040124131E-4
tuberculosis and treatment for 6 months 686 4.77564318249398E-4
atypical teratoid / rhabdoid tumor 4369 4.7972189924324E-4
pancreatic cancer 2300 4.99768103558432E-4
pancreatic carcinoma 567 4.99768103558434E-4
ductal carcinoma in situ 1745 7.27071033165735E-4
COPD 116 0.00107507181038573
ovarian cancer 8492 0.00209893364640535
invasive ductal carcinoma 2950 0.00263796715211589
nephrosclerosis 329 0.00275400468998522
pituitary cancer 1972 0.00480703655302685
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00496958547486381
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00730234077021264
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0126365908516297
mucosa-associated lymphoid tissue lymphoma 480 0.0425422788988137

Expression

Synonym

Accession A0AV96 A0PJK2 B5MED4 Q8NI52 Q8NI53 Q9NXG3
Symbols NET18

Gene

PDB

2DIS  

  Ortholog (13)

Gene RIF (2)

PMID Text
24898756 RBM47 is an RNA-binding protein that can suppress breast cancer progression
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTAEDSTAAMSSDSAAGSSAKVPEGVAGAPNEAALLALMERTGYSMVQENGQRKYGGPPPGWEGPHPQRG      1 - 70
CEVFVGKIPRDVYEDELVPVFEAVGRIYELRLMMDFDGKNRGYAFVMYCHKHEAKRAVRELNNYEIRPGR     71 - 140
LLGVCCSVDNCRLFIGGIPKMKKREEILEEIAKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMA    141 - 210
RRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTEDTIKKSFGQFNPGCVERVKKI    211 - 280
RDYAFVHFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGAAEAAQQPSYVYSCD    281 - 350
PYTLAYYGYPYNALIGPNRDYFVKAGSIRGRGRGAAGNRAPGPRGSYLGGYSAGRGIYSRYHEGKGKQQE    351 - 420
KGYELVPNLEIPTVNPVAIKPGTVAIPAIGAQYSMFPAAPAPKMIEDGKIHTVEHMISPIAVQPDPASAA    421 - 490
AAAAAAAAAAAAVIPTVSTPPPFQGRPITPVYTVAPNVQRIPTAGIYGASYVPFAAPATATIATLQKNAA    491 - 560
AAAAMYGGYAGYIPQAFPAAAIQVPIPDVYQTY                                         561 - 593
//

Text Mined References (14)

PMID Year Title
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
24898756 2014 Loss of the multifunctional RNA-binding protein RBM47 as a source of selectable metastatic traits in breast cancer.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...