Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A0A0C4DH73
Symbols L19
IGKV112

Gene

 Compartment GO Term (0)

AA Sequence

MDMRVPAQLLGLLLLWFPGSRCDIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLI      1 - 70
YAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFP                            71 - 117
//

Text Mined References (8)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11549845 2001 Nomenclature of the human immunoglobulin kappa (IGK) genes.
8223863 1993 The V kappa genes of the L regions and the repertoire of V kappa gene sequences in the human germ line.
6087280 1984 Molecular footprints of human immunoglobulin gene evolution: a new sequence family.
6086934 1984 Organization and evolution of a gene cluster for human immunoglobulin variable regions of the kappa type.