Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A0A087WTH1
Symbols IFITMD8

Gene

 Compartment GO Term (0)

AA Sequence

MEDEEKAVEILGNTEAAHPPSPIRCCWLRLRCLAATSIICGCSCLGVMALVFAIKAEERHKAGRSEEAVR      1 - 70
WGARARKLILASFAVWLAVLILGPLLLWLLSYAIAQAE                                     71 - 108
//

Text Mined References (5)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11181995 2001 The sequence of the human genome.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.