Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A0A075B6S6
Symbols A1
IGKV2D30

Gene

 Compartment GO Term (0)

AA Sequence

MRLPAQLLGLLMLWVPGSSGDVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPR      1 - 70
RLIYKVSNWDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP                         71 - 120
//

Text Mined References (7)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11549845 2001 Nomenclature of the human immunoglobulin kappa (IGK) genes.
11298326 2001 Evolutionary dynamics of the human immunoglobulin kappa locus and the germline repertoire of the Vkappa genes.
1551402 1992 The human immunoglobulin kappa locus. Characterization of the duplicated A regions.