You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SEMA3B
Semaphorin-3B

Protein Summary
Description
Inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons. The protein encoded by this gene belongs to the class-3 semaphorin/collapsin family, whose members function in growth cone guidance during neuronal development. This family member inhibits axonal extension and has been shown to act as a tumor suppressor by inducing apoptosis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000433753
  • ENSP00000485281
  • ENSG00000012171
  • ENST00000616701
  • ENSP00000484146
  • ENST00000618865
  • ENSP00000481957

Symbol
  • SEMA5
  • SEMAA
  • SemA
  • SEMA5
  • SEMAA
  • semaV
  • LUCA-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.97
transcription factor perturbation
0.74
transcription factor
0.73
PubMedID
0.66
cellular component
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 88.82   (req: < 5)
Gene RIFs: 29   (req: <= 3)
Antibodies: 135   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 88.82   (req: >= 5)
Gene RIFs: 29   (req: > 3)
Antibodies: 135   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (14)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (86)
1 – 10 of 86
GLDC
Tbio
Family: Enzyme
Novelty: 0.01431753
p_int: 0.965691067
p_ni: 0.034308856
p_wrong: 7.7e-8
Data Source: BioPlex
HSPA5
Tchem
Novelty: 0.00051387
p_int: 0.839656116
p_ni: 0.160343884
Data Source: BioPlex
NRP1
Tchem
Novelty: 0.00183532
Score: 0.981
Data Source: STRINGDB
PLXNA2
Tbio
Novelty: 0.00307834
Score: 0.965
Data Source: STRINGDB
PLXNA3
Tbio
Novelty: 0.01306168
Score: 0.965
Data Source: STRINGDB
PLXNA4
Tbio
Novelty: 0.02675586
Score: 0.964
Data Source: STRINGDB
PLXNB3
Tbio
Novelty: 0.05652272
Score: 0.926
Data Source: STRINGDB
PLXNB1
Tbio
Novelty: 0.01392457
Score: 0.922
Data Source: STRINGDB
PLXND1
Tbio
Novelty: 0.0184122
Score: 0.919
Data Source: STRINGDB
NRP2
Tbio
Novelty: 0.00918546
Score: 0.918
Data Source: STRINGDB
Publication Statistics
PubMed Score  88.82

PubMed score by year
PubTator Score  63.47

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGRAGAAAVIPGLALLWAVGLGSAAPSPPRLRLSFQELQAWHGLQTFSLERTCCYQALLVDEERGRLFVG
1-70
AENHVASLNLDNISKRAKKLAWPAPVEWREECNWAGKDIGTECMNFVKLLHAYNRTHLLACGTGAFHPTC
70-140
AFVEVGHRAEEPVLRLDPGRIEDGKGKSPYDPRHRAASVLVGEELYSGVAADLMGRDFTIFRSLGQRPSL
140-210
RTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETAVEAAPALGRLSVSRVGQICRNDVGGQRSLV
210-280
NKWTTFLKARLVCSVPGVEGDTHFDQLQDVFLLSSRDHRTPLLYAVFSTSSSIFQGSAVCVYSMNDVRRA
280-350
FLGPFAHKEGPMHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVIQFARNHPLMYNSVLPTGGRPL
350-420
FLQVGANYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVISVPKGSRPSAEGLLLEELHVFEDSAAVTS
420-490
MQISSKRHQLYVASRSAVAQIALHRCAAHGRVCTECCLARDPYCAWDGVACTRFQPSAKRRFRRQDVRNG
490-560
DPSTLCSGDSSRPALLEHKVFGVEGSSAFLECEPRSLQARVEWTFQRAGVTAHTQVLAEERTERTARGLL
560-630
LRRLRRRDSGVYLCAAVEQGFTQPLRRLSLHVLSATQAERLARAEEAAPAAPPGPKLWYRDFLQLVEPGG
630-700
GGSANSLRMCRPQPALQSLPLESRRKGRNRRTHAPEPRAERGPRSATHW
700-749
MGRAGAAAVIPGLALLWAVGLGSAAPSPPRLRLSFQELQAWHGLQTFSLERTCCYQALLVDEERGRLFVGAENHVASLNLDNISKRAKKLAWPAPVEWREECNWAGKDIGTECMNFVKLLHAYNRTHLLACGTGAFHPTCAFVEVGHRAEEPVLRLDPGRIEDGKGKSPYDPRHRAASVLVGEELYSGVAADLMGRDFTIFRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETAVEAAPALGRLSVSRVGQICRNDVGGQRSLVNKWTTFLKARLVCSVPGVEGDTHFDQLQDVFLLSSRDHRTPLLYAVFSTSSSIFQGSAVCVYSMNDVRRAFLGPFAHKEGPMHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVIQFARNHPLMYNSVLPTGGRPLFLQVGANYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVISVPKGSRPSAEGLLLEELHVFEDSAAVTSMQISSKRHQLYVASRSAVAQIALHRCAAHGRVCTECCLARDPYCAWDGVACTRFQPSAKRRFRRQDVRNGDPSTLCSGDSSRPALLEHKVFGVEGSSAFLECEPRSLQARVEWTFQRAGVTAHTQVLAEERTERTARGLLLRRLRRRDSGVYLCAAVEQGFTQPLRRLSLHVLSATQAERLARAEEAAPAAPPGPKLWYRDFLQLVEPGGGGSANSLRMCRPQPALQSLPLESRRKGRNRRTHAPEPRAERGPRSATHW