You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SESN1
Sestrin-1

Protein Summary
Description
Functions as an intracellular leucine sensor that negatively regulates the TORC1 signaling pathway through the GATOR complex. In absence of leucine, binds the GATOR subcomplex GATOR2 and prevents TORC1 signaling. Binding of leucine to SESN2 disrupts its interaction with GATOR2 thereby activating the TORC1 signaling pathway (PubMed:25263562, PubMed:26449471). This stress-inducible metabolic regulator may also play a role in protection against oxidative and genotoxic stresses (By similarity). May positively regulate the transcription by NFE2L2 of genes involved in the response to oxidative stress by facilitating the SQSTM1-mediated autophagic degradation of KEAP1 (PubMed:23274085). May have an alkylhydroperoxide reductase activity born by the N-terminal domain of the protein (By similarity). Was originally reported to contribute to oxidative stress resistance by reducing PRDX1 (PubMed:15105503). However, this could not be confirmed (By similarity). This gene encodes a member of the sestr ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000302071
  • ENSP00000306734
  • ENSG00000080546
  • ENST00000356644
  • ENSP00000349061
  • ENST00000436639
  • ENSP00000393762

Symbol
  • PA26
  • SEST1
  • PA26
  • SEST1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.97
kinase perturbation
0.88
disease perturbation
0.83
transcription factor binding site profile
0.82
gene perturbation
0.78


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 86.81   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 241   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 86.81   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 241   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (12)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
RNA Polymerase II Transcription
Reactome
TP53 Regulates Metabolic Genes
Reactome
Transcriptional Regulation by TP53
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
RNA Polymerase II Transcription
TP53 Regulates Metabolic Genes
Transcriptional Regulation by TP53
Protein-Protein Interactions (78)
1 – 10 of 78
SESN2
Tbio
Novelty: 0.00594978
Score: 0.807
Data Source: STRINGDB
SESN3
Tbio
Novelty: 0.05189758
Score: 0.806
Data Source: STRINGDB
CACNA2D2
Tclin
Family: IC
Novelty: 0.0236407
Score: 0.801
Data Source: STRINGDB
PRKAB1
Tchem
Family: Kinase
Novelty: 0.027886
Score: 0.752
Data Source: Reactome,STRINGDB
WDR59
Tdark
Novelty: 0.27755881
Score: 0.747
Data Source: STRINGDB
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.745
Data Source: STRINGDB
MIOS
Tdark
Novelty: 0.03378873
Score: 0.745
Data Source: STRINGDB
PRKAB2
Tchem
Family: Enzyme
Novelty: 0.05936112
Score: 0.737
Data Source: Reactome,STRINGDB
WDR24
Tdark
Novelty: 1.44736842
Score: 0.719
Data Source: STRINGDB
TSC2
Tbio
Novelty: 0.00092908
Score: 0.677
Data Source: STRINGDB
Publication Statistics
PubMed Score  86.81

PubMed score by year
PubTator Score  29.82

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRLAAAANEAYTAPLAVSGLLGCKQCGGGRDQDEELGIRIPRPLGQGPSRFIPEKEILQVGSEDAQMHAL
1-70
FADSFAALGRLDNITLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIGIMAAARHQCSYLVNLHVND
70-140
FLHVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAELVHAVVLLTHYH
140-210
SLASFTFGCGISPEIHCDGGHTFRPPSVSNYCICDITNGNHSVDEMPVNSAENVSVSDSFFEVEALMEKM
210-280
RQLQECRDEEEASQEEMASRFEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFR
280-350
VQDYCWEDHGYSLVNRLYPDVGQLIDEKFHIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDY
350-420
DYGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDSFWRQFKHSEKVHVNLLLIEARMQAELLYALRAITRY
420-490
MT
490-492
MRLAAAANEAYTAPLAVSGLLGCKQCGGGRDQDEELGIRIPRPLGQGPSRFIPEKEILQVGSEDAQMHALFADSFAALGRLDNITLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIGIMAAARHQCSYLVNLHVNDFLHVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAELVHAVVLLTHYHSLASFTFGCGISPEIHCDGGHTFRPPSVSNYCICDITNGNHSVDEMPVNSAENVSVSDSFFEVEALMEKMRQLQECRDEEEASQEEMASRFEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYCWEDHGYSLVNRLYPDVGQLIDEKFHIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDYDYGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDSFWRQFKHSEKVHVNLLLIEARMQAELLYALRAITRYMT