You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IGF2BP2
Insulin-like growth factor 2 mRNA-binding protein 2

Protein Summary
Description
RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). This transcript 'caging' into mRNPs allows mRNA transport and transient storage. It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation (By similarity). Binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Binding is isoform-specific. Binds to beta-actin/ACTB and MYC transcripts. This gene encodes a protein that binds the 5' UTR of insulin-like growth factor 2 (IGF2) mRNA and regulates its translation. It plays an important role in metabolism and variation in this gene is associated with susceptibility to diabetes. Alternative splicing and promoter usage results in multiple transcript variants. Related pseudogenes are found on several chromosomes. [provided by RefSeq, Sep 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000346192
  • ENSP00000320204
  • ENSG00000073792
  • ENST00000382199
  • ENSP00000371634
  • ENST00000421047
  • ENSP00000413787

Symbol
  • IMP2
  • VICKZ2
  • IMP2
  • IMP-2
  • VICKZ2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.95
PubMedID
0.87
trait
0.86
microRNA
0.76
gene perturbation
0.75


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 65.55   (req: < 5)
Gene RIFs: 82   (req: <= 3)
Antibodies: 537   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 65.55   (req: >= 5)
Gene RIFs: 82   (req: > 3)
Antibodies: 537   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (2)
Insulin-like Growth Factor-2 mRNA Binding Proteins (IGF2BPs/IMPs/VICKZs) bind RNA (R-HSA-428359)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Insulin-like Growth Factor-2 mRNA Binding Proteins (IGF2BPs/IMPs/VICKZs) bind RNA
Reactome
Metabolism of RNA
Name
Explore in Pharos
Explore in Source
Insulin-like Growth Factor-2 mRNA Binding Proteins (IGF2BPs/IMPs/VICKZs) bind RNA
Metabolism of RNA
Gene Ontology Terms (13)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Protein-Protein Interactions (77)
1 – 10 of 77
MAP7
Tbio
Novelty: 0.02738196
p_int: 0.92530101
p_ni: 0.07469899
Data Source: BioPlex
LARP4B
Tbio
Novelty: 0.153294
p_int: 0.922929033
p_ni: 0.077070967
Data Source: BioPlex
ELAVL2
Tbio
Novelty: 0.0071859
p_int: 0.851526702
p_ni: 0.148473298
Score: 0.282
Data Source: BioPlex,STRINGDB
RPL23A
Tbio
Novelty: 0.03695788
p_int: 0.791504845
p_ni: 0.208495155
Data Source: BioPlex
IGF2
Tbio
Novelty: 0.00024884
Score: 0.913
Data Source: STRINGDB
CDKAL1
Tbio
Family: Enzyme
Novelty: 0.01389805
Score: 0.89
Data Source: STRINGDB
SLC30A8
Tbio
Family: Transporter
Novelty: 0.00552632
Score: 0.836
Data Source: STRINGDB
TCF7L2
Tbio
Family: TF
Novelty: 0.00205974
Score: 0.819
Data Source: STRINGDB
HHEX
Tbio
Family: TF
Novelty: 0.00053222
Score: 0.789
Data Source: STRINGDB
KCNJ11
Tclin
Family: IC
Novelty: 0.00090113
Score: 0.738
Data Source: STRINGDB
Publication Statistics
PubMed Score  65.55

PubMed score by year
PubTator Score  75.67

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIME
1-70
VDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKL
70-140
SGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIG
140-210
KEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKIL
210-280
AHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFE
280-350
NDMLAVNQQANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPH
350-420
HHSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQG
420-490
RIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVR
490-560
IIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK
560-599
MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFENDMLAVNQQANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK