You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SAR1B
GTP-binding protein SAR1b

Protein Summary
Description
Involved in transport from the endoplasmic reticulum to the Golgi apparatus. Activated by the guanine nucleotide exchange factor PREB. Involved in the selection of the protein cargo and the assembly of the COPII coat complex. The protein encoded by this gene is a small GTPase that acts as a homodimer. The encoded protein is activated by the guanine nucleotide exchange factor PREB and is involved in protein transport from the endoplasmic reticulum to the Golgi. This protein is part of the COPII coat complex. Defects in this gene are a cause of chylomicron retention disease (CMRD), also known as Anderson disease (ANDD). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Mar 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000402673
  • ENSP00000385432
  • ENSG00000152700
  • ENST00000439578
  • ENSP00000404997

Symbol
  • SARA2
  • SARB
  • ANDD
  • CMRD
  • GTBPB
  • SARA2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.97
kinase perturbation
0.93
molecular function
0.93
histone modification site profile
0.83
cell type or tissue
0.78


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 85.43   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 248   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 85.43   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 248   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (26)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 22
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen Presentation: Folding, assembly and peptide loading of class I MHC
Reactome
Asparagine N-linked glycosylation
Reactome
COPII-mediated vesicle transport
Reactome
Cargo concentration in the ER
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen Presentation: Folding, assembly and peptide loading of class I MHC
Asparagine N-linked glycosylation
COPII-mediated vesicle transport
Cargo concentration in the ER
Gene Ontology Terms (19)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (218)
1 – 10 of 218
SAR1A
Tbio
Family: Enzyme
Novelty: 0.07402125
p_int: 0.999999998
p_ni: 2e-9
Score: 0.896
Data Source: BioPlex,STRINGDB
NT5E
Tchem
Family: Enzyme
Novelty: 0.00121213
p_int: 0.908220729
p_ni: 0.091777476
p_wrong: 0.000001796
Data Source: BioPlex
SRPRB
Tbio
Novelty: 0.03850629
p_int: 0.86460194
p_ni: 0.13539806
Score: 0.383
Data Source: BioPlex,STRINGDB
PLPPR2
Tdark
Family: Enzyme
Novelty: 1.875
p_int: 0.85970215
p_ni: 0.14029785
Score: 0.161
Data Source: BioPlex,STRINGDB
SNRNP27
Tbio
Novelty: 0.00944493
p_int: 0.83708872
p_ni: 0.16291128
Score: 0.176
Data Source: BioPlex,STRINGDB
TCL1B
Tbio
Novelty: 0.00845828
p_int: 0.82521613
p_ni: 0.174783869
Score: 0.165
Data Source: BioPlex,STRINGDB
SEC23A
Tbio
Novelty: 0.0358158
Score: 0.991
Data Source: Reactome,STRINGDB
SEC24A
Tbio
Novelty: 0.14959041
Score: 0.991
Data Source: Reactome,STRINGDB
PREB
Tbio
Family: TF
Novelty: 0.00430442
Score: 0.988
Data Source: Reactome,STRINGDB
SEC31A
Tbio
Novelty: 0.06064315
Score: 0.987
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  85.43

PubMed score by year
PubTator Score  47.29

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT
1-70
FTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPILILGNKIDRPE
70-140
AISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYID
140-198
MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYID