You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
AUP1
Ancient ubiquitous protein 1

Protein Summary
Description
May play a role in the translocation of terminally misfolded proteins from the endoplasmic reticulum lumen to the cytoplasm and their degradation by the proteasome. The protein encoded this gene is involved in several pathways including quality control of misfolded proteins in the endoplasmic reticulum and lipid droplet accumulation. Lipid droplets are organelles in the cytoplasm that store neutral lipids such as cholesterol esters and trigylycerides to prevent the overabundance of free cholesterol and fatty acids in cells, but also to act as storage for other metabolic processes, such as membrane biogenesis. Reduced expression of this gene results in reduced lipid droplet clustering, a function that is dependent on ubiquitination of the protein. This protein contains multiple domains including a hydrophobic N-terminal domain, an acetyltranferase domain, a ubiquitin-binding CUE domain, and a UBE2B2-binding domain (G2BR). Alternative splicing results in multiple transcript variants. [pr ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000377526
  • ENSP00000366748
  • ENSG00000115307
  • ENST00000425118
  • ENSP00000403430
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.9
disease perturbation
0.87
transcription factor binding site profile
0.84
kinase perturbation
0.76
interacting protein
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.9   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 179   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.9   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 179   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (96)
1 – 10 of 96
ABRAXAS2
Tbio
Novelty: 0.30679328
p_int: 0.982445575
p_ni: 0.017554425
Score: 0.189
Data Source: BioPlex,STRINGDB
FNTB
Tchem
Family: Enzyme
Novelty: 0.13625417
p_int: 0.974025232
p_ni: 0.025974768
Score: 0.529
Data Source: BioPlex,STRINGDB
RNF114
Tbio
Family: Enzyme
Novelty: 0.07098319
p_int: 0.96924771
p_ni: 0.030752268
p_wrong: 2.3e-8
Score: 0.211
Data Source: BioPlex,STRINGDB
APOB
Tchem
Novelty: 0.00010107
p_int: 0.878641691
p_ni: 0.121358305
p_wrong: 4e-9
Score: 0.545
Data Source: BioPlex,STRINGDB
PTP4A1
Tchem
Family: Enzyme
Novelty: 0.01186241
p_int: 0.865121752
p_ni: 0.134878246
p_wrong: 2e-9
Score: 0.826
Data Source: BioPlex,STRINGDB
SEL1L
Tbio
Novelty: 0.01113296
Score: 0.986
Data Source: STRINGDB
SYVN1
Tbio
Family: Enzyme
Novelty: 0.02889919
Score: 0.986
Data Source: STRINGDB
OS9
Tbio
Novelty: 0.01598375
Score: 0.938
Data Source: STRINGDB
UBE2G2
Tbio
Novelty: 0.05545031
Score: 0.904
Data Source: STRINGDB
FAF2
Tbio
Novelty: 0.03242029
Score: 0.883
Data Source: STRINGDB
Publication Statistics
PubMed Score  13.90

PubMed score by year
PubTator Score  12.2

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MELPSGPGPERLFDSHRLPGDCFLLLVLLLYAPVGFCLLVLRLFLGIHVFLVSCALPDSVLRRFVVRTMC
1-70
AVLGLVARQEDSGLRDHSVRVLISNHVTPFDHNIVNLLTTCSTPLLNSPPSFVCWSRGFMEMNGRGELVE
70-140
SLKRFCASTRLPPTPLLLFPEEEATNGREGLLRFSSWPFSIQDVVQPLTLQVQRPLVSVTVSDASWVSEL
140-210
LWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQS
210-280
AQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQ
280-350
SLPTASASKFPSSGPVTPQPTALTFAKSSWARQESLQERKQALYEYARRRFTERRAQEAD
350-410
MELPSGPGPERLFDSHRLPGDCFLLLVLLLYAPVGFCLLVLRLFLGIHVFLVSCALPDSVLRRFVVRTMCAVLGLVARQEDSGLRDHSVRVLISNHVTPFDHNIVNLLTTCSTPLLNSPPSFVCWSRGFMEMNGRGELVESLKRFCASTRLPPTPLLLFPEEEATNGREGLLRFSSWPFSIQDVVQPLTLQVQRPLVSVTVSDASWVSELLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPTASASKFPSSGPVTPQPTALTFAKSSWARQESLQERKQALYEYARRRFTERRAQEAD