Protein Summary
Chromatin reader that specifically recognizes and binds histone H3 both trimethylated at 'Lys-4' and asymmetrically dimethylated at 'Arg-8' (H3K4me3 and H3R8me2a) and acts as an activator of Wnt signaling pathway downstream of PRMT2. In case of cancer, promotes cell cancer proliferation via activation of the Wnt signaling pathway (PubMed:24589551). Overexpression induces metaphase arrest and chromosomal instability. Localizes to active rDNA loci and promotes the expression of rRNA genes (PubMed:21960006). May play a role in cell-cycle regulation during the transition from gamete to embryo. Involved in oocyte meiotic resumption, a process that takes place before ovulation to resume meiosis of oocytes blocked in prophase I: may act by regulating maternal transcripts to control meiotic resumption.
- ENST00000375859
- ENSP00000365019
- ENSG00000106723
- OCR
- SPIN
- SPIN
- TDRD24
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
kinase perturbation | 1 | ||
transcription factor perturbation | 0.98 | ||
virus perturbation | 0.85 | ||
transcription factor binding site profile | 0.77 | ||
histone modification site profile | 0.71 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 115.37 (req: < 5)
Gene RIFs: 16 (req: <= 3)
Antibodies: 181 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 115.37 (req: >= 5)
Gene RIFs: 16 (req: > 3)
Antibodies: 181 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 9
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Protein Data Bank (8)
1 – 5 of 8
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Gene Ontology Terms (15)
Functions (1)
Components (6)
Processes (8)
Items per page:
10
1 – 1 of 1
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Protein-Protein Interactions (33)
1 – 10 of 33
SPINDOC
Novelty: 4
p_int: 1
Score: 0.91
Data Source: BioPlex,STRINGDB
SPIN2B
Novelty: 0.03496843
p_int: 1
Score: 0.814
Data Source: BioPlex,STRINGDB
CGGBP1
Novelty: 0.09064411
p_int: 0.999999582
p_ni: 4.18e-7
Score: 0.825
Data Source: BioPlex,STRINGDB
YRDC
Novelty: 0.01588082
p_int: 0.999936655
p_ni: 0.000063345
Score: 0.85
Data Source: BioPlex,STRINGDB
TOPORS
Family: Enzyme
Novelty: 0.01054772
p_int: 0.999901912
p_ni: 0.000098086
p_wrong: 2e-9
Score: 0.738
Data Source: BioPlex,STRINGDB
SCNM1
Novelty: 0.24120603
p_int: 0.999807211
p_ni: 0.000192405
p_wrong: 3.84e-7
Score: 0.188
Data Source: BioPlex,STRINGDB
ZNF324B
Family: TF
Novelty: 2.4
p_int: 0.999286877
p_ni: 0.000713123
Data Source: BioPlex
ZGPAT
Family: Epigenetic
Novelty: 0.3373494
p_int: 0.999061123
p_ni: 0.000935412
p_wrong: 0.000003465
Score: 0.259
Data Source: BioPlex,STRINGDB
PAX3
Family: TF
Novelty: 0.00139998
p_int: 0.952767386
p_ni: 8.06e-7
p_wrong: 0.047231809
Score: 0.356
Data Source: BioPlex,STRINGDB
SF3A3
Novelty: 0.05151585
p_int: 0.763672599
p_ni: 0.236327401
Score: 0.413
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score 115.37
PubMed score by year
PubTator Score 6644.78
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVT
1-70
QWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHM
70-140
FETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVV
140-210
DSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS
210-262
MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS
Find similar targets by: