You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PSAT1
Phosphoserine aminotransferase

Protein Summary
Description
Catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. This gene encodes a member of the class-V pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is a phosphoserine aminotransferase and decreased expression may be associated with schizophrenia. Mutations in this gene are also associated with phosphoserine aminotransferase deficiency. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, and 8. [provided by RefSeq, Jul 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000347159
  • ENSP00000317606
  • ENSG00000135069
  • ENST00000376588
  • ENSP00000365773

Symbol
  • PSA
  • PSA
  • EPIP
  • NLS2
  • PSAT
  • PSATD
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.99
gene perturbation
0.97
small molecule perturbation
0.96
transcription factor perturbation
0.96
disease perturbation
0.95


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 203.02   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 212   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 203.02   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 212   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (46)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of amino acids and derivatives
Reactome
Serine biosynthesis
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of amino acids and derivatives
Serine biosynthesis
Protein-Protein Interactions (133)
1 – 10 of 133
MPRIP
Tbio
Family: Enzyme
Novelty: 0.06222313
p_int: 0.847552999
p_ni: 0.152415514
p_wrong: 0.000031487
Score: 0.507
Data Source: BioPlex,STRINGDB
PHGDH
Tbio
Family: Enzyme
Novelty: 0.00062836
Score: 0.999
Data Source: STRINGDB
PSPH
Tbio
Family: Enzyme
Novelty: 0.01529803
Score: 0.996
Data Source: STRINGDB
VPS29
Tbio
Novelty: 0.02138387
Score: 0.9
Data Source: STRINGDB
SHMT2
Tbio
Family: Enzyme
Novelty: 0.00406219
Score: 0.868
Data Source: STRINGDB
ALDH18A1
Tbio
Family: Enzyme
Novelty: 0.00370889
Score: 0.834
Data Source: STRINGDB
SHMT1
Tbio
Family: Enzyme
Novelty: 0.00263085
Score: 0.822
Data Source: STRINGDB
ASNS
Tchem
Family: Enzyme
Novelty: 0.00372649
Score: 0.817
Data Source: STRINGDB
SHTN1
Tbio
Novelty: 0.074568
Score: 0.817
Data Source: STRINGDB
STAT6
Tchem
Family: TF
Novelty: 0.00118956
Score: 0.799
Data Source: STRINGDB
Publication Statistics
PubMed Score  203.02

PubMed score by year
PubTator Score  114.79

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNY
1-70
KVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTW
70-140
NLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVV
140-210
IVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYE
210-280
IIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVT
280-350
IEDVQKLAAFMKKFLEMHQL
350-370
MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL