You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KLF2
Krueppel-like factor 2

Protein Summary
Description
Transcription factor that binds to the CACCC box in the promoter of target genes such as HBB/beta globin or NOV and activates their transcription. This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is expressed early in mammalian development and is found in many different cell types. The protein acts to bind the CACCC box found in the promoter of target genes to activate their transcription. It plays a role in many processes during development and disease including adipogenesis, embryonic erythropoiesis, epithelial integrity, inflammation and t-cell viability. [provided by RefSeq, Mar 2017]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000248071
  • ENSP00000248071
  • ENSG00000127528

Symbol
  • LKLF
  • LKLF
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
1
small molecule perturbation
0.93
biological process
0.9
gene perturbation
0.85
biological term
0.78


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 275.13   (req: < 5)
Gene RIFs: 122   (req: <= 3)
Antibodies: 400   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 275.13   (req: >= 5)
Gene RIFs: 122   (req: > 3)
Antibodies: 400   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 27
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (6)
Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
FoxO signaling pathway
KEGG
Apelin signaling pathway
KEGG
Fluid shear stress and atherosclerosis
Name
Explore in Pharos
Explore in Source
FoxO signaling pathway
Apelin signaling pathway
Fluid shear stress and atherosclerosis
Protein-Protein Interactions (127)
1 – 10 of 127
S1PR1
Tclin
Family: GPCR
Novelty: 0.00202384
Score: 0.882
Data Source: STRINGDB
FOXO1
Tbio
Family: TF
Novelty: 0.00076606
Score: 0.878
Data Source: STRINGDB
NFKB1
Tclin
Family: TF
Novelty: 0.00165205
Score: 0.848
Data Source: STRINGDB
RELA
Tchem
Family: TF
Novelty: 0.00091233
Score: 0.844
Data Source: STRINGDB
NOS3
Tchem
Family: Enzyme
Novelty: 0.00010217
Score: 0.844
Data Source: STRINGDB
SELL
Tchem
Novelty: 0.00035489
Score: 0.802
Data Source: STRINGDB
MYC
Tbio
Family: TF
Novelty: 0.000073
Score: 0.786
Data Source: STRINGDB
MAPK7
Tchem
Family: Kinase
Novelty: 0.00301243
Score: 0.77
Data Source: STRINGDB
THBD
Tbio
Novelty: 0.00046438
Score: 0.758
Data Source: STRINGDB
NANOG
Tbio
Family: TF
Novelty: 0.00073323
Score: 0.755
Data Source: STRINGDB
Publication Statistics
PubMed Score  275.13

PubMed score by year
PubTator Score  167.66

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEAAPEPPPPPPP
1-70
PAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRLVKAEPPEADGGGGYGCAPGL
70-140
TRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDGPARLPAPGPRASFPPPFGGPGFGAPGPGLH
140-210
YAPPAPPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCG
210-280
KTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH
280-350
MKRHM
350-355
MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEAAPEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRLVKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDGPARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM