You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ENTPD2
Ectonucleoside triphosphate diphosphohydrolase 2

Protein Summary
Description
In the nervous system, could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. Hydrolyzes ADP only to a marginal extent. The order of activity with different substrates is ATP > GTP > CTP = ITP > UTP >> ADP = UDP. The protein encoded by this gene is the type 2 enzyme of the ecto-nucleoside triphosphate diphosphohydrolase family (E-NTPDase). E-NTPDases are a family of ecto-nucleosidases that hydrolyze 5'-triphosphates. This ecto-ATPase is an integral membrane protein. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000312665
  • ENSP00000312494
  • ENSG00000054179
  • ENST00000355097
  • ENSP00000347213

Symbol
  • CD39L1
  • CD39L1
  • NTPDase-2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.9
disease perturbation
0.79
cellular component
0.7
PubMedID
0.66
cell type or tissue
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 581.09   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 204   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 581.09   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 204   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
PSB-6426
chemical structure image
Pathways (8)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of nucleotides
Reactome
Nucleobase catabolism
Reactome
Phosphate bond hydrolysis by NTPDase proteins
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of nucleotides
Nucleobase catabolism
Phosphate bond hydrolysis by NTPDase proteins
Protein-Protein Interactions (131)
1 – 10 of 131
AK8
Tbio
Family: Kinase
Novelty: 0.10878907
Score: 0.937
Data Source: STRINGDB
AK1
Tbio
Family: Kinase
Novelty: 0.00447903
Score: 0.937
Data Source: STRINGDB
NTPCR
Tbio
Family: Enzyme
Novelty: 0.05949008
Score: 0.93
Data Source: STRINGDB
PKLR
Tbio
Family: Kinase
Novelty: 0.00411221
Score: 0.923
Data Source: STRINGDB
NME3
Tbio
Family: Kinase
Novelty: 0.01659326
Score: 0.919
Data Source: STRINGDB
ENTPD8
Tbio
Family: Enzyme
Novelty: 0.01333714
Score: 0.915
Data Source: STRINGDB
AK2
Tbio
Family: Kinase
Novelty: 0.00910897
Score: 0.914
Data Source: STRINGDB
NME6
Tbio
Family: Kinase
Novelty: 0.1631596
Score: 0.913
Data Source: STRINGDB
PKM
Tchem
Family: Kinase
Novelty: 0.00066016
Score: 0.913
Data Source: STRINGDB
AK5
Tbio
Family: Kinase
Novelty: 0.01573129
Score: 0.912
Data Source: STRINGDB
Publication Statistics
PubMed Score  581.09

PubMed score by year
PubTator Score  31.96

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVG
1-70
QHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVL
70-140
MAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQIT
140-210
FETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVY
210-280
QSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFY
280-350
TVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAF
350-420
GGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALVLLLRQVHSAK
420-490
LPSTI
490-495
MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALVLLLRQVHSAKLPSTI