You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ANGPTL3
Angiopoietin-related protein 3

Protein Classes
Protein Summary
Description
Acts in part as a hepatokine that is involved in regulation of lipid and glucose metabolism (PubMed:11788823, PubMed:12909640, PubMed:23661675, PubMed:25495645). Proposed to play a role in the trafficking of energy substrates to either storage or oxidative tissues in response to food intake (By similarity). Has a stimulatory effect on plasma triglycerides (TG), which is achieved by suppressing plasma TG clearance via inhibition of LPL activity. The inhibition of LPL activity appears to be an indirect mechanism involving recruitment of proprotein convertases PCSK6 and FURIN to LPL leading to cleavage and dissociation of LPL from the cell surface; the function does not require ANGPTL3 proteolytic cleavage but seems to be mediated by the N-terminal domain, and is not inhibited by GPIHBP1 (PubMed:12097324, PubMed:19318355, PubMed:20581395). Can inhibit endothelial lipase, causing increased plasma levels of high density lipoprotein (HDL) cholesterol and phospholipids (PubMed:17110602, PubMe ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000371129
  • ENSP00000360170
  • ENSG00000132855

Symbol
  • ANGPT5
  • ANL3
  • ANG-5
  • FHBL2
  • ANGPT5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.84
biological process
0.79
gene perturbation
0.76
biological term
0.56
tissue
0.51


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 137.69   (req: < 5)
Gene RIFs: 57   (req: <= 3)
Antibodies: 474   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 137.69   (req: >= 5)
Gene RIFs: 57   (req: > 3)
Antibodies: 474   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 28
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (6)
Assembly of active LPL and LIPC lipase complexes (R-HSA-8963889)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Assembly of active LPL and LIPC lipase complexes
Reactome
Plasma lipoprotein assembly, remodeling, and clearance
Reactome
Plasma lipoprotein remodeling
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Assembly of active LPL and LIPC lipase complexes
Plasma lipoprotein assembly, remodeling, and clearance
Plasma lipoprotein remodeling
Transport of small molecules
Protein-Protein Interactions (115)
1 – 10 of 115
CCDC91
Tbio
Novelty: 0.12993039
p_int: 0.999900211
p_ni: 0.000087844
p_wrong: 0.000011946
Score: 0.332
Data Source: BioPlex,STRINGDB
GULP1
Tbio
Novelty: 0.01241977
p_int: 0.999545931
p_ni: 0.000454017
p_wrong: 5.2e-8
Score: 0.252
Data Source: BioPlex,STRINGDB
FBXO28
Tbio
Novelty: 0.12833512
p_int: 0.999417986
p_ni: 0.000582014
Score: 0.179
Data Source: BioPlex,STRINGDB
BIRC6
Tbio
Novelty: 0.01472975
p_int: 0.993239067
p_ni: 0.006760933
Score: 0.188
Data Source: BioPlex,STRINGDB
ANGPTL8
Tbio
Novelty: 0.00741238
Score: 0.994
Data Source: Reactome,STRINGDB
LPL
Tchem
Family: Enzyme
Novelty: 0.00074704
Score: 0.981
Data Source: STRINGDB
GPIHBP1
Tbio
Novelty: 0.01411894
Score: 0.966
Data Source: STRINGDB
ITGB3
Tclin
Novelty: 0.00086996
Score: 0.942
Data Source: STRINGDB
ITGAV
Tchem
Novelty: 0.00217401
Score: 0.938
Data Source: STRINGDB
ANGPTL4
Tbio
Novelty: 0.00295835
Score: 0.831
Data Source: STRINGDB
Publication Statistics
PubMed Score  137.69

PubMed score by year
PubTator Score  124.78

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQIND
1-70
IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKY
70-140
LEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQE
140-210
PTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGS
210-280
PWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFY
280-350
LGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKP
350-420
RAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
420-460
MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE