You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SUPT16H
FACT complex subunit SPT16

Protein Summary
Description
Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II. The FACT complex is probably also involved in phosphorylation of 'Ser-392' of p53/TP53 via its association with CK2 (casein kinase II). Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessor ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000216297
  • ENSP00000216297
  • ENSG00000092201

Symbol
  • FACT140
  • FACTP140
  • CDC68
  • SPT16
  • FACTP140
  • SPT16/CDC68
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
1
hub protein
0.94
transcription factor perturbation
0.84
histone modification site profile
0.83
transcription factor binding site profile
0.78


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 72.9   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 388   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 72.9   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 388   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (24)
Disease (R-HSA-1643685)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 24
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Disease
Reactome
Formation of HIV elongation complex in the absence of HIV Tat
Reactome
Formation of HIV-1 elongation complex containing HIV-1 Tat
Reactome
Formation of RNA Pol II elongation complex
Reactome
Gene expression (Transcription)
Name
Explore in Pharos
Explore in Source
Disease
Formation of HIV elongation complex in the absence of HIV Tat
Formation of HIV-1 elongation complex containing HIV-1 Tat
Formation of RNA Pol II elongation complex
Gene expression (Transcription)
Gene Ontology Terms (16)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (317)
1 – 10 of 317
H2AFX
Tbio
Novelty: 0.00052244
p_int: 0.999989719
p_ni: 0.000010281
Score: 0.752
Data Source: BioPlex,STRINGDB
SSRP1
Tbio
Family: TF
Novelty: 0.01607158
p_int: 0.999989518
p_ni: 0.000010482
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
HIST1H2BA
Tbio
Novelty: 0.03503778
p_int: 0.999988776
p_ni: 0.000011224
Score: 0.9
Data Source: BioPlex,STRINGDB
MACROD1
Tbio
Family: Enzyme
Novelty: 0.0451872
p_int: 0.999636243
p_ni: 0.000363757
Score: 0.583
Data Source: BioPlex,STRINGDB
APLF
Tbio
Novelty: 0.01671154
p_int: 0.999137156
p_ni: 0.000862844
Score: 0.812
Data Source: BioPlex,STRINGDB
HIST1H3A
Tbio
Novelty: 0.01912636
p_int: 0.998783508
p_ni: 0.001216493
Score: 0.787
Data Source: BioPlex,STRINGDB
CHD1L
Tbio
Family: Enzyme
Novelty: 0.00580143
p_int: 0.99822298
p_ni: 0.00177702
Score: 0.897
Data Source: BioPlex,STRINGDB
H2AFY2
Tbio
Novelty: 0.1240707
p_int: 0.997753583
p_ni: 0.002246417
Score: 0.485
Data Source: BioPlex,STRINGDB
XPC
Tbio
Novelty: 0.00902281
p_int: 0.997377701
p_ni: 0.002622299
Score: 0.848
Data Source: BioPlex,STRINGDB
XRCC6
Tbio
Novelty: 0.0013086
p_int: 0.996647744
p_ni: 0.003352256
Score: 0.803
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  72.90

PubMed score by year
PubTator Score  30.9

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCD
1-70
DKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIKESKNGKKIGVFSKD
70-140
KFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADE
140-210
KVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFK
210-280
SYCSNLVRTLMVDPSQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGF
280-350
GMGIEFREGSLVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTS
350-420
VKKKVKNVGIFLKNEDEEEEEEEKDEAEDLLGRGSRAALLTERTRNEMTAEEKRRAHQKELAAQLNEEAK
420-490
RRLTEQKGEQQIQKARKSNVSYKNPSLMPKEPHIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMS
490-560
VEGDYTYLRINFYCPGSALGRNEGNIFPNPEATFVKEITYRASNIKAPGEQTVPALNLQNAFRIIKEVQK
560-630
RYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDIL
630-700
YNNIKHALFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMER
700-770
EMRHKLKTAFKNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNATEWPPFVVTLDEV
770-840
ELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWLNSCDLKYTEGVQSLNWTKIMKTIV
840-910
DDPEGFFEQGGWSFLEPEGEGSDAEEGDSESEIEDETFNPSEDDYEEEEEDSDEDYSSEAEESDYSKESL
910-980
GSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKRKASVHSSGRGSNRGSRHSSAPPKKKRK
980-1047
MAVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIKESKNGKKIGVFSKDKFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGFGMGIEFREGSLVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTSVKKKVKNVGIFLKNEDEEEEEEEKDEAEDLLGRGSRAALLTERTRNEMTAEEKRRAHQKELAAQLNEEAKRRLTEQKGEQQIQKARKSNVSYKNPSLMPKEPHIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPGSALGRNEGNIFPNPEATFVKEITYRASNIKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMEREMRHKLKTAFKNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNATEWPPFVVTLDEVELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWLNSCDLKYTEGVQSLNWTKIMKTIVDDPEGFFEQGGWSFLEPEGEGSDAEEGDSESEIEDETFNPSEDDYEEEEEDSDEDYSSEAEESDYSKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKRKASVHSSGRGSNRGSRHSSAPPKKKRK