You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RWDD3
RWD domain-containing protein 3

Protein Summary
Description
Enhancer of SUMO conjugation. Via its interaction with UBE2I/UBC9, increases SUMO conjugation to proteins by promoting the binding of E1 and E2 enzymes, thioester linkage between SUMO and UBE2I/UBC9 and transfer of SUMO to specific target proteins which include HIF1A, PIAS, NFKBIA, NR3C1 and TOP1. Isoform 1 and isoform 2 positively regulate the NF-kappa-B signaling pathway by enhancing the sumoylation of NF-kappa-B inhibitor alpha (NFKBIA), promoting its stabilization which consequently leads to an increased inhibition of NF-kappa-B transcriptional activity. Isoform 1 and isoform 2 negatively regulate the hypoxia-inducible factor-1 alpha (HIF1A) signaling pathway by increasing the sumoylation of HIF1A, promoting its stabilization, transcriptional activity and the expression of its target gene VEGFA during hypoxia. Isoform 2 promotes the sumoylation and transcriptional activity of the glucocorticoid receptor NR3C1 and enhances the interaction of SUMO1 and NR3C1 with UBE2I/UBC9. Has no e ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000263893
  • ENSP00000263893
  • ENSG00000122481
  • ENST00000370202
  • ENSP00000359221

Symbol
  • RSUME
  • RSUME
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.83
transcription factor binding site profile
0.83
transcription factor perturbation
0.74
kinase perturbation
0.71
cell type or tissue
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.39   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 108   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.39   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 108   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
Post-translational protein modification
Reactome
Processing and activation of SUMO
Reactome
SUMO is transferred from E1 to E2 (UBE2I, UBC9)
Reactome
SUMOylation
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
Post-translational protein modification
Processing and activation of SUMO
SUMO is transferred from E1 to E2 (UBE2I, UBC9)
SUMOylation
Gene Ontology Terms (5)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (16)
1 – 10 of 16
UBE2I
Tbio
Novelty: 0.00316288
Score: 0.992
Data Source: STRINGDB
SUMO1
Tbio
Novelty: 0.00169202
Score: 0.963
Data Source: STRINGDB
SAE1
Tbio
Novelty: 0.02519067
Score: 0.926
Data Source: STRINGDB
UBA2
Tbio
Novelty: 0.02816874
Score: 0.923
Data Source: STRINGDB
HIF1A
Tchem
Family: TF
Novelty: 0.00031917
Score: 0.676
Data Source: STRINGDB
TMEM56
Tdark
Novelty: 1.51898734
Score: 0.598
Data Source: STRINGDB
VHL
Tchem
Family: Enzyme
Novelty: 0.00323188
Score: 0.559
Data Source: STRINGDB
SENP1
Tchem
Family: Enzyme
Novelty: 0.00919181
Score: 0.517
Data Source: STRINGDB
RWDD4
Tdark
Novelty: 0.6
Score: 0.474
Data Source: STRINGDB
RWDD2B
Tdark
Novelty: 2
Score: 0.448
Data Source: STRINGDB
Publication Statistics
PubMed Score  12.39

PubMed score by year
PubTator Score  8.4

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAEPVQEELSVLAAIFCRPHEWEVLSRSETDGTVFRIHTKAEGFMDVDIPLELVFHLPVNYPSCLPGISI
1-70
NSEQLTRAQCVTVKENLLEQAESLLSEPMVHELVLWIQQNLRHILSQPETGSGSEKCTFSTSTTMDDGLW
70-140
ITLLHLDHMRAKTKYVKIVEKWASDLRLTGRLMFMGKIILILLQGDRNNLKEYLILQKTSKVDVDSSGKK
140-210
CKEKMISVLFETKVQTEHKRFLAFEVKEYSALDELQKEFETAGLKKLFSEFVLALVK
210-267
MAEPVQEELSVLAAIFCRPHEWEVLSRSETDGTVFRIHTKAEGFMDVDIPLELVFHLPVNYPSCLPGISINSEQLTRAQCVTVKENLLEQAESLLSEPMVHELVLWIQQNLRHILSQPETGSGSEKCTFSTSTTMDDGLWITLLHLDHMRAKTKYVKIVEKWASDLRLTGRLMFMGKIILILLQGDRNNLKEYLILQKTSKVDVDSSGKKCKEKMISVLFETKVQTEHKRFLAFEVKEYSALDELQKEFETAGLKKLFSEFVLALVK