You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DHRS7
Dehydrogenase/reductase SDR family member 7

Protein Summary
Description
This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family, which has over 46,000 members. Members in this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids and xenobiotics. [provided by RefSeq, Apr 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000216500
  • ENSP00000216500
  • ENSG00000100612
  • ENST00000536410
  • ENSP00000442993
  • ENST00000557185
  • ENSP00000451882

Symbol
  • DHRS7A
  • RETSDR4
  • SDR34C1
  • CGI-86
  • SDR34C1
  • retDSR4
  • retSDR4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
pathway
0.95
virus perturbation
0.92
disease perturbation
0.9
transcription factor perturbation
0.8
histone modification site profile
0.77


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.4   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 221   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.4   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 221   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (2)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (54)
1 – 10 of 54
SCN3B
Tbio
Family: IC
Novelty: 0.08995222
p_int: 0.999999407
p_ni: 5.93e-7
Data Source: BioPlex
ATP2B2
Tbio
Family: Transporter
Novelty: 0.00724828
p_int: 0.99987465
p_ni: 0.00012535
Score: 0.172
Data Source: BioPlex,STRINGDB
SCN1B
Tbio
Family: IC
Novelty: 0.0144817
p_int: 0.988381985
p_ni: 0.011614421
p_wrong: 0.000003594
Data Source: BioPlex
TMEM30A
Tbio
Novelty: 0.05869796
p_int: 0.987877396
p_ni: 0.012122599
p_wrong: 5e-9
Score: 0.362
Data Source: BioPlex,STRINGDB
SRPRB
Tbio
Novelty: 0.03850629
p_int: 0.986736747
p_ni: 0.013263253
Score: 0.162
Data Source: BioPlex,STRINGDB
PCDHGA5
Tdark
p_int: 0.98081586
p_ni: 0.01918414
Data Source: BioPlex
PTGER3
Tclin
Family: GPCR
Novelty: 0.00155764
p_int: 0.978452952
p_ni: 0.021547048
Data Source: BioPlex
TGFA
Tbio
Novelty: 0.00259473
p_int: 0.972337246
p_ni: 0.027662751
p_wrong: 3e-9
Data Source: BioPlex
CPNE5
Tbio
Novelty: 0.17144272
p_int: 0.969841322
p_ni: 0.030158678
Data Source: BioPlex
PCDHA3
Tdark
Novelty: 2.54545455
p_int: 0.955897193
p_ni: 0.044102807
Data Source: BioPlex
Publication Statistics
PubMed Score  5.40

PubMed score by year
PubTator Score  5.94

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNWELLLWLLVLCALLLLLVQLLRFLRADGDLTLLWAEWQGRRPEWELTDMVVWVTGASSGIGEELAYQL
1-70
SKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGG
70-140
MSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHAL
140-210
RGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMAND
210-280
LKEVWISEQPFLLVTYLWQYMPTWAWWITNKMGKKRIENFKSGVDADSSYFKIFKTKHD
280-339
MNWELLLWLLVLCALLLLLVQLLRFLRADGDLTLLWAEWQGRRPEWELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTYLWQYMPTWAWWITNKMGKKRIENFKSGVDADSSYFKIFKTKHD