You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
LUC7L2
Putative RNA-binding protein Luc7-like 2

Protein Summary
Description
May bind to RNA via its Arg/Ser-rich domain. This gene encodes a protein that contains a C2H2-type zinc finger, coiled-coil region and arginine, serine-rich (RS) domain. A similar protein in mouse interacts with sodium channel modifier 1, and the encoded protein may be involved in the recognition of non-consensus splice donor sites in association with the U1 snRNP spliceosomal subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000263545
  • ENSP00000263545
  • ENSG00000146963
  • ENST00000354926
  • ENSP00000347005
  • ENST00000541170
  • ENSP00000441604
  • ENST00000619796
  • ENSP00000483438

Symbol
  • CGI-59
  • CGI-74
  • LUC7B2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.99
transcription factor perturbation
0.99
disease perturbation
0.95
kinase perturbation
0.93
virus perturbation
0.92


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.01   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 124   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.01   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 124   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (7)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (142)
1 – 10 of 142
CLASRP
Tbio
Novelty: 0.00099222
p_int: 0.999999901
p_ni: 9.9e-8
Data Source: BioPlex
JMJD6
Tbio
Family: Enzyme
Novelty: 0.00134844
p_int: 0.999999877
p_ni: 1.23e-7
Score: 0.361
Data Source: BioPlex,STRINGDB
GPATCH8
Tdark
Novelty: 0.59308072
p_int: 0.999999083
p_ni: 9.17e-7
Data Source: BioPlex
ACIN1
Tbio
Novelty: 0.00112465
p_int: 0.999991411
p_ni: 0.000008589
Data Source: BioPlex
CCDC9
Tdark
p_int: 0.999976794
p_ni: 0.000023205
p_wrong: 1e-9
Data Source: BioPlex
ZRANB2
Tbio
Novelty: 0.02084407
p_int: 0.999892775
p_ni: 0.000107225
Data Source: BioPlex
PAIP2B
Tbio
Novelty: 0.86657497
p_int: 0.999720092
p_ni: 0.000279908
Data Source: BioPlex
RNPS1
Tbio
Novelty: 0.03863535
p_int: 0.999667499
p_ni: 0.000332501
Score: 0.198
Data Source: BioPlex,STRINGDB
PNN
Tbio
Novelty: 0.00945912
p_int: 0.999606691
p_ni: 0.000393309
Score: 0.271
Data Source: BioPlex,STRINGDB
SRSF12
Tbio
Novelty: 0.8
p_int: 0.99951017
p_ni: 0.000489827
p_wrong: 3e-9
Score: 0.307
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  1.01

PubMed score by year
PubTator Score  2.91

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSAQAQMRAMLDQLMGTSRDGDTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRAD
1-70
YEIASKEQDFFFELDAMDHLQSFIADCDRRTEVAKKRLAETQEEISAEVAAKAERVHELNEEIGKLLAKV
70-140
EQLGAEGNVEESQKVMDEVEKARAKKREAEEVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHF
140-210
GGKLHLGFIEIREKLEELKRVVAEKQEKRNQERLKRREEREREEREKLRRSRSHSKNPKRSRSREHRRHR
210-280
SRSMSRERKRRTRSKSREKRHRHRSRSSSRSRSRSHQRSRHSSRDRSRERSKRRSSKERFRDQDLASCDR
280-350
DRSSRDRSPRDRDRKDKKRSYESANGRSEDRRSSEEREAGEI
350-392
MSAQAQMRAMLDQLMGTSRDGDTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIASKEQDFFFELDAMDHLQSFIADCDRRTEVAKKRLAETQEEISAEVAAKAERVHELNEEIGKLLAKVEQLGAEGNVEESQKVMDEVEKARAKKREAEEVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLEELKRVVAEKQEKRNQERLKRREEREREEREKLRRSRSHSKNPKRSRSREHRRHRSRSMSRERKRRTRSKSREKRHRHRSRSSSRSRSRSHQRSRHSSRDRSRERSKRRSSKERFRDQDLASCDRDRSSRDRSPRDRDRKDKKRSYESANGRSEDRRSSEEREAGEI