You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC27A5
Bile acyl-CoA synthetase

Protein Classes
Protein Summary
Description
Acyl-CoA synthetase involved in bile acid metabolism. Proposed to catalyze the first step in the conjugation of C24 bile acids (choloneates) to glycine and taurine before excretion into bile canaliculi by activating them to their CoA thioesters. Seems to activate secondary bile acids entering the liver from the enterohepatic circulation. In vitro, also activates 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. The protein encoded by this gene is an isozyme of very long-chain acyl-CoA synthetase (VLCS). It is capable of activating very long-chain fatty-acids containing 24- and 26-carbons. It is expressed in liver and associated with endoplasmic reticulum but not with peroxisomes. Its primary role is in fatty acid elongation or complex lipid synthesis rather than in degradation. This gene has a mouse ortholog. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000263093
  • ENSP00000263093
  • ENSG00000083807
  • ENST00000601355
  • ENSP00000470368

Symbol
  • ACSB
  • ACSVL6
  • FACVL3
  • FATP5
  • BAL
  • ACSB
  • BACS
  • FATP5
  • ACSVL6
  • FACVL3
  • FATP-5
  • VLACSR
  • VLCSH2
  • VLCS-H2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.98
cellular component
0.73
kinase perturbation
0.66
cell type or tissue
0.63
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 233.92   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 279   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 233.92   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 279   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (38)
Bile acid and bile salt metabolism (R-HSA-194068)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Bile acid and bile salt metabolism
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Metabolism of steroids
Reactome
Recycling of bile acids and salts
Name
Explore in Pharos
Explore in Source
Bile acid and bile salt metabolism
Metabolism
Metabolism of lipids
Metabolism of steroids
Recycling of bile acids and salts
Gene Ontology Terms (19)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (56)
1 – 10 of 56
BAAT
Tbio
Family: Enzyme
Novelty: 0.0194259
Score: 0.965
Data Source: STRINGDB
SCP2
Tchem
Novelty: 0.00215179
Score: 0.952
Data Source: STRINGDB
CYP27A1
Tchem
Family: Enzyme
Novelty: 0.00095128
Score: 0.939
Data Source: STRINGDB
AMACR
Tbio
Family: Enzyme
Novelty: 0.0026828
Score: 0.932
Data Source: STRINGDB
ACOT8
Tbio
Family: Enzyme
Novelty: 0.00367339
Score: 0.809
Data Source: STRINGDB
COASY
Tbio
Family: Enzyme
Novelty: 0.00555161
Score: 0.71
Data Source: STRINGDB
ACSBG2
Tdark
Family: Enzyme
Novelty: 0.35673769
Score: 0.695
Data Source: STRINGDB
ACSL1
Tbio
Family: Enzyme
Novelty: 0.00272619
Score: 0.689
Data Source: STRINGDB
ZNF132
Tdark
Family: TF
Novelty: 0.36082474
Score: 0.655
Data Source: STRINGDB
ZNF584
Tdark
Family: TF
Novelty: 2.5
Score: 0.618
Data Source: STRINGDB
Publication Statistics
PubMed Score  233.92

PubMed score by year
PubTator Score  215.79

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGVRQQLALLLLLLLLLWGLGQPVWPVAVALTLRWLLGDPTCCVLLGLAMLARPWLGPWVPHGLSLAAAA
1-70
LALTLLPARLPPGLRWLPADVIFLAKILHLGLKIRGCLSRQPPDTFVDAFERRARAQPGRALLVWTGPGA
70-140
GSVTFGELDARACQAAWALKAELGDPASLCAGEPTALLVLASQAVPALCMWLGLAKLGCPTAWINPHGRG
140-210
MPLAHSVLSSGARVLVVDPDLRESLEEILPKLQAENIRCFYLSHTSPTPGVGALGAALDAAPSHPVPADL
210-280
RAGITWRSPALFIYTSGTTGLPKPAILTHERVLQMSKMLSLSGATADDVVYTVLPLYHVMGLVVGILGCL
280-350
DLGATCVLAPKFSTSCFWDDCRQHGVTVILYVGELLRYLCNIPQQPEDRTHTVRLAMGNGLRADVWETFQ
350-420
QRFGPIRIWEVYGSTEGNMGLVNYVGRCGALGKMSCLLRMLSPFELVQFDMEAAEPVRDNQGFCIPVGLG
420-490
EPGLLLTKVVSQQPFVGYRGPRELSERKLVRNVRQSGDVYYNTGDVLAMDREGFLYFRDRLGDTFRWKGE
490-560
NVSTHEVEGVLSQVDFLQQVNVYGVCVPGCEGKVGMAAVQLAPGQTFDGEKLYQHVRAWLPAYATPHFIR
560-630
IQDAMEVTSTFKLMKTRLVREGFNVGIVVDPLFVLDNRAQSFRPLTAEMYQAVCEGTWRL
630-690
MGVRQQLALLLLLLLLLWGLGQPVWPVAVALTLRWLLGDPTCCVLLGLAMLARPWLGPWVPHGLSLAAAALALTLLPARLPPGLRWLPADVIFLAKILHLGLKIRGCLSRQPPDTFVDAFERRARAQPGRALLVWTGPGAGSVTFGELDARACQAAWALKAELGDPASLCAGEPTALLVLASQAVPALCMWLGLAKLGCPTAWINPHGRGMPLAHSVLSSGARVLVVDPDLRESLEEILPKLQAENIRCFYLSHTSPTPGVGALGAALDAAPSHPVPADLRAGITWRSPALFIYTSGTTGLPKPAILTHERVLQMSKMLSLSGATADDVVYTVLPLYHVMGLVVGILGCLDLGATCVLAPKFSTSCFWDDCRQHGVTVILYVGELLRYLCNIPQQPEDRTHTVRLAMGNGLRADVWETFQQRFGPIRIWEVYGSTEGNMGLVNYVGRCGALGKMSCLLRMLSPFELVQFDMEAAEPVRDNQGFCIPVGLGEPGLLLTKVVSQQPFVGYRGPRELSERKLVRNVRQSGDVYYNTGDVLAMDREGFLYFRDRLGDTFRWKGENVSTHEVEGVLSQVDFLQQVNVYGVCVPGCEGKVGMAAVQLAPGQTFDGEKLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVDPLFVLDNRAQSFRPLTAEMYQAVCEGTWRL