You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
KDM2A
Lysine-specific demethylase 2A

Protein Summary
Description
Histone demethylase that specifically demethylates 'Lys-36' of histone H3, thereby playing a central role in histone code. Preferentially demethylates dimethylated H3 'Lys-36' residue while it has weak or no activity for mono- and tri-methylated H3 'Lys-36'. May also recognize and bind to some phosphorylated proteins and promote their ubiquitination and degradation. Required to maintain the heterochromatic state. Associates with centromeres and represses transcription of small non-coding RNAs that are encoded by the clusters of satellite repeats at the centromere. Required to sustain centromeric integrity and genomic stability, particularly during mitosis. This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins ar ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000398645
  • ENSP00000381640
  • ENSG00000173120
  • ENST00000529006
  • ENSP00000432786
  • ENST00000530342
  • ENSP00000435776

Symbol
  • CXXC8
  • FBL7
  • FBXL11
  • JHDM1A
  • KIAA1004
  • FBL7
  • CXXC8
  • FBL11
  • FBXL11
  • JHDM1A
  • LILINA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.97
transcription factor perturbation
0.88
transcription factor
0.85
ligand (protein) perturbation
0.83
transcription factor binding site profile
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 44.89   (req: < 5)
Gene RIFs: 27   (req: <= 3)
Antibodies: 243   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 44.89   (req: >= 5)
Gene RIFs: 27   (req: > 3)
Antibodies: 243   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 18
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (18)
1 – 10 of 18
CHEMBL2392184
chemical structure image
CHEMBL2164243
chemical structure image
CHEMBL3108958
chemical structure image
CHEMBL2164246
chemical structure image
CHEMBL3785340
chemical structure image
CHEMBL1229308,CHEMBL1215519
chemical structure image
IOX2
chemical structure image
CHEMBL51979
chemical structure image
CHEMBL3786265
chemical structure image
CHEMBL3786188
chemical structure image
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (3)
Chromatin modifying enzymes (R-HSA-3247509)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Chromatin modifying enzymes
Reactome
Chromatin organization
Reactome
HDMs demethylate histones
Name
Explore in Pharos
Explore in Source
Chromatin modifying enzymes
Chromatin organization
HDMs demethylate histones
Gene Ontology Terms (8)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (148)
1 – 10 of 148
SKP1
Tbio
Family: Enzyme
Novelty: 0.00209659
p_int: 0.999999986
p_ni: 1.3e-8
Score: 0.987
Data Source: BioPlex,STRINGDB
CGB2
Tdark
Novelty: 0.01059323
p_int: 0.999999227
p_ni: 7.73e-7
Data Source: BioPlex
HIST3H3
Tbio
Novelty: 0.09996887
Score: 0.831
Data Source: STRINGDB
KMT2D
Tbio
Family: Epigenetic
Novelty: 0.00631634
Score: 0.826
Data Source: STRINGDB
EP300
Tchem
Family: Epigenetic
Novelty: 0.00060382
Score: 0.819
Data Source: STRINGDB
HIST1H4A
Tbio
Novelty: 0.00536075
Score: 0.791
Data Source: STRINGDB
HIST1H4G
Tdark
Novelty: 3
Score: 0.764
Data Source: STRINGDB
KDM6A
Tchem
Family: Epigenetic
Novelty: 0.0039701
Score: 0.761
Data Source: STRINGDB
HIST1H3A
Tbio
Novelty: 0.01912636
Score: 0.759
Data Source: STRINGDB
HIST2H3A
Tbio
Novelty: 0.04593632
Score: 0.759
Data Source: STRINGDB
Publication Statistics
PubMed Score  44.89

PubMed score by year
PubTator Score  38.21

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEPEEERIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQRG
1-70
GLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKL
70-140
YNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQKYCLMSVRGCYTD
140-210
FHVDFGGTSVWYHIHQGGKVFWLIPPTAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPS
210-280
GWIHAVYTPTDTLVFGGNFLHSFNIPMQLKIYNIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHL
280-350
TKEFQKESLSMDLELNGLESGNGDEEAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKT
350-420
LAGDSSSDCSRGSHNGQVWDPQCAPRKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIA
420-490
DVKILLEELANSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKPHTMKPAPRLTPVRPAAASPI
490-560
VSGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRMKQSCVLRQCLAPRLPHSVTCSLCGEVDQNE
560-630
ETQDFEKKLMECCICNEIVHPGCLQMDGEGLLNEELPNCWECPKCYQEDSSEKAQKRKMEESDEEAVQAK
630-700
VLRPLRSCDEPLTPPPHSPTSMLQLIHDPVSPRGMVTRSSPGAGPSDHHSASRDERFKRRQLLRLQATER
700-770
TMVREKENNPSGKKELSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQAITASSANLRHSPRVLVQHC
770-840
PARTPQRGDEEGLGGEEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESWMQREVWMSVFRYLSRREL
840-910
CECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLSWTNISKKQLTWLVNRLPGLK
910-980
DLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIRDLLTPPADKPGQDNRSKLRNMTDFRLAGLD
980-1050
ITDATLRLIIRHMPLLSRLDLSHCSHLTDQSSNLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIAN
1050-1120
VTLIDLRGCKQITRKACEHFISDLSINSLYCLSDEKLIQKIS
1120-1162
MEPEEERIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFLHSFNIPMQLKIYNIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKEFQKESLSMDLELNGLESGNGDEEAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKTLAGDSSSDCSRGSHNGQVWDPQCAPRKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELANSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKPHTMKPAPRLTPVRPAAASPIVSGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRMKQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEGLLNEELPNCWECPKCYQEDSSEKAQKRKMEESDEEAVQAKVLRPLRSCDEPLTPPPHSPTSMLQLIHDPVSPRGMVTRSSPGAGPSDHHSASRDERFKRRQLLRLQATERTMVREKENNPSGKKELSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQAITASSANLRHSPRVLVQHCPARTPQRGDEEGLGGEEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESWMQREVWMSVFRYLSRRELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLSWTNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIRDLLTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQSSNLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIANVTLIDLRGCKQITRKACEHFISDLSINSLYCLSDEKLIQKIS